ATP2C1 Antibody (2G1) - Azide and BSA Free

Western Blot: ATP2C1 Antibody (2G1) [H00027032-M01] - ATP2C1 monoclonal antibody (M01), clone 2G1 Analysis of ATP2C1 expression in HeLa.

Immunocytochemistry/Immunofluorescence: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of monoclonal antibody to ATP2C1 on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of ATP2C1 over-expressed 293 cell line, cotransfected with ATP2C1 Validated Chimera RNAi ( Cat # H00027032-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ATP2C1 monoclonal antibody (M01), clone 2G1 (Cat # H00027032-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of ATP2C1 expression in transfected 293T cell line by ATP2C1 monoclonal antibody (M01), clone 2G1.Lane 1: ATP2C1 transfected lysate(100.6 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of ATP2C1 transfected lysate using anti-ATP2C1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ATP2C1 MaxPab rabbit polyclonal antibody.

ELISA: ATP2C1 Antibody (2G1) [H00027032-M01] - Detection limit for recombinant GST tagged ATP2C1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IP, Mycoplasma
• Clone: 2G1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP2C1 Antibody (2G1) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ATP2C1 Antibody (2G1) - Azide and BSA Free (H00027032-M01) is a monoclonal antibody validated for use in WB, ELISA, ICC/IF and IP. Anti-ATP2C1 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ATP2C1 (AAH28139, 119 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL
• Specificity: ATP2C1 - ATPase, Ca++ transporting, type 2C, member 1
• Isotype: IgG1 Lambda
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATP2C1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunoprecipitation
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP2C1 Antibody (2G1) - Azide and BSA Free

• ATPase, Ca++ transporting, type 2C, member 1
• BCPM
• benign chronic pemphigus (Hailey-Hailey disease)
• Ca(2+)-sequestering
• calcium-transporting ATPase type 2C member 1
• EC 3.6.3
• HHD
• hSPCA1
• HUSSY-28
• PMR1L
• secretory pathway Ca2+/Mn2+ ATPase 1

Background

The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP2C1 Antibody (H00027032-M01)(7)

Publications using H00027032-M01

• Kiss A, Varga �, Görög M et al. Store-independent activation of STIM1-ORAI1 by SPCA2 determines the basal CFTR activity in secretory epithelial cells. Current biology : CB 2025-09-26 [PMID: 41015040]
• Steimle BL, Bailey DK, Smith FM Et al. Calcium and the Ca-ATPase SPCA1 modulate plasma membrane abundance of ZIP8 and ZIP14 to regulate Mn(II) uptake in brain microvascular endothelial cells J Biol Chem 2022-07-05 [PMID: 35787370] (ICC/IF, WB, Human)
  
  Details:
  Citation using the Alexa Fluor 647 version of this antibody.
• Victoria M, Garrett B, Tyne T et al. The Golgi calcium ATPase pump plays an essential role in AAV trafficking and transduction. J Virol. 2020-08-19 [PMID: 32817219]
• Deng Y, Pakdel M, Blank B et al. Activity of the SPCA1 Calcium Pump Couples Sphingomyelin Synthesis to Sorting of Secretory Proteins in the Trans-Golgi Network. Dev Cell 2018-11-01 [PMID: 30393074]
• Hoffmann HH, Schneider WM, Blomen VA et al. Diverse Viruses Require the Calcium Transporter SPCA1 for Maturation and Spread. Cell Host Microbe 2017-10-11 [PMID: 29024641]
• Kienzle C, Basnet N, Crevenna AH et al. Cofilin recruits F-actin to SPCA1 and promotes Ca2+-mediated secretory cargo sorting. J Cell Biol. 2014-09-01 [PMID: 25179631] (Human)
• Grice DM, Vetter I, Faddy HM. Golgi calcium pump secretory pathway calcium ATPase 1 (SPCA1) is a key regulator of insulin-like growth factor receptor (IGF1R) processing in the basal-like breast cancer cell line MDA-MB-231. J Biol Chem 285(48):37458-66. 2010-11-26 [PMID: 20837466]

Bioinformatics

• Gene Symbol: ATP2C1
• Entrez:
  • 27032(Human)
• OMIM:
  • 169(Human)
• Uniprot:
  • AAH28139(Human)