Recombinant Human ATP12A Protein

Images

 
SDS-Page: Recombinant Human ATP12A Protein [H00000479-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ATP12A Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 174 - 281 of Human ATP12A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYSTTCLEASTSPVGTVTGMVIN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATP12A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP12A Protein

  • ATP1AL1non-gastric H(+)/K(+) ATPase alpha subunit
  • ATPase, H+/K+ transporting, nongastric, alpha polypeptide
  • ATPase, Na+/K+ transporting, alpha polypeptide-like 1
  • EC 3.6.3
  • EC 3.6.3.10
  • Non-gastric H(+)/K(+) ATPase subunit alpha
  • potassium-transporting ATPase alpha chain 2
  • Proton pump

Background

ATP12A - ATPase, H+/K+ transporting, nongastric, alpha polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-540
Species: Hu, Mu, Rt, Bv, Ca, GP, Pm, Rb, Sh
Applications: WB, Simple Western, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-146
Species: Hu, Mu, Rt, Po, Bv, Ca, Dr, GP, Pm, Rb, Xp, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000480-R04
Species: Hu
H00057167-M03
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP1-88552
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATP12A Partial Recombinant Protein (H00000479-Q01) (0)

There are no publications for ATP12A Partial Recombinant Protein (H00000479-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP12A Partial Recombinant Protein (H00000479-Q01) (0)

There are no reviews for ATP12A Partial Recombinant Protein (H00000479-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP12A Partial Recombinant Protein (H00000479-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP12A Products

Bioinformatics Tool for ATP12A Partial Recombinant Protein (H00000479-Q01)

Discover related pathways, diseases and genes to ATP12A Partial Recombinant Protein (H00000479-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP12A Partial Recombinant Protein (H00000479-Q01)

Discover more about diseases related to ATP12A Partial Recombinant Protein (H00000479-Q01).
 

Pathways for ATP12A Partial Recombinant Protein (H00000479-Q01)

View related products by pathway.

PTMs for ATP12A Partial Recombinant Protein (H00000479-Q01)

Learn more about PTMs related to ATP12A Partial Recombinant Protein (H00000479-Q01).

Blogs on ATP12A

There are no specific blogs for ATP12A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATP12A Antibody
NBP1-88886

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP12A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP12A