ATP12A Antibody

Product Discontinued

ATP12A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHKLSNRELEEKYGTDIIMGLSSTR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP12A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 25993003). For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25993003).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP12A Antibody

• ATP1AL1non-gastric H(+)/K(+) ATPase alpha subunit
• ATPase, H+/K+ transporting, nongastric, alpha polypeptide
• ATPase, Na+/K+ transporting, alpha polypeptide-like 1
• EC 3.6.3
• EC 3.6.3.10
• Non-gastric H(+)/K(+) ATPase subunit alpha
• potassium-transporting ATPase alpha chain 2
• Proton pump

Background

ATP12A is encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP12A Antibody (NBP1-88886)(2)

Publications using NBP1-88886

• Lennox AT, Coburn SL, Leech JA, Heidrich EM. ATP12A promotes mucus dysfunction during Type 2 airway inflammation. Sci Rep. 2018-02-01 [PMID: 29391451] (WB, Human)
• Wang J, Barbuskaite D, Tozzi M et al. Proton Pump Inhibitors Inhibit Pancreatic Secretion: Role of Gastric and Non-Gastric H+/K+-ATPases. PLoS One 2015-01-01 [PMID: 25993003] (WB, Mouse)

Bioinformatics

• Gene Symbol: ATP12A