ATP12A Antibody

Images

 
Western Blot: ATP12A Antibody [NBP1-88886] - Analysis in control (vector only transfected HEK293T lysate) and ATP12A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: ATP12A Antibody [NBP1-88886] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP12A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHKLSNRELEEKYGTDIIMGLSSTR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP12A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP12A Protein (NBP1-88886PEP)
Publications
Read Publication using
NBP1-88886 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25993003).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP12A Antibody

  • ATP1AL1non-gastric H(+)/K(+) ATPase alpha subunit
  • ATPase, H+/K+ transporting, nongastric, alpha polypeptide
  • ATPase, Na+/K+ transporting, alpha polypeptide-like 1
  • EC 3.6.3
  • EC 3.6.3.10
  • Non-gastric H(+)/K(+) ATPase subunit alpha
  • potassium-transporting ATPase alpha chain 2
  • Proton pump

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-540
Species: Hu, Mu, Rt, Bv, Ca, GP, Pm, Rb, Sh
Applications: WB, Simple Western, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-146
Species: Hu, Mu, Rt, Po, Bv, Ca, Dr, GP, Pm, Rb, Xp, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000480-R04
Species: Hu
H00057167-M03
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP1-88552
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATP12A Antibody (NBP1-88886)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ATP12A Antibody (NBP1-88886) (0)

There are no reviews for ATP12A Antibody (NBP1-88886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP12A Antibody (NBP1-88886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP12A Products

Bioinformatics Tool for ATP12A Antibody (NBP1-88886)

Discover related pathways, diseases and genes to ATP12A Antibody (NBP1-88886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP12A Antibody (NBP1-88886)

Discover more about diseases related to ATP12A Antibody (NBP1-88886).
 

Pathways for ATP12A Antibody (NBP1-88886)

View related products by pathway.

PTMs for ATP12A Antibody (NBP1-88886)

Learn more about PTMs related to ATP12A Antibody (NBP1-88886).

Blogs on ATP12A

There are no specific blogs for ATP12A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP12A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP12A