ATP11B Antibody (4H8) - Azide and BSA Free

Western Blot: ATP11B Antibody (4H8) [H00023200-M01] - Detection against Immunogen (35.75 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4H8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP11B Antibody (4H8) - Azide and BSA Free Summary

• Immunogen: ATP11B (NP_055431, 1087 a.a. ~ 1177 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC
• Specificity: ATP11B - ATPase, Class VI, type 11B
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATP11B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP11B Antibody (4H8) - Azide and BSA Free

• ATPase class VI type 11B
• ATPase IR
• ATPase, class VI, type 11B
• ATPIFKIAA0956probable phospholipid-transporting ATPase IF
• ATPIRMGC46576
• DKFZp434J238
• DKFZp434N1615
• EC 3.6.3
• EC 3.6.3.1

Background

P-type ATPases, such as ATP11B, are phosphorylated in their intermediate state and drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily transports heavy metal ions, such as Cu(2+) or Cd(2+). Another subfamily transports non-heavy metal ions, such as H(+), Na(+), K(+), or Ca(+). A third subfamily transports amphipaths, such as phosphatidylserine.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP11B
• Entrez:
  • 23200(Human)
• OMIM:
  • 605869(Human)
• Uniprot:
  • NP_055431(Human)