ATP10B Antibody

Images

 
Immunohistochemistry: ATP10B Antibody [NBP1-90840] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in a subset of glial cells and neuropil was distinctly stained..

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP10B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RLETPKELDSDGEEWTQYQCLSFSARWAQDPATMRSQKGAQPLRRSQSARVPIQGHYRQRSMGHRESSQPPVAFSSSIEKDVTPDKNLLTKVRDAALWL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP10B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP10B Protein (NBP1-90840PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP10B Antibody

  • ATPase, class V, type 10B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001307-R01
Species: Hu
NBP2-30403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-31415
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-185
Species: Hu
Applications: WB
H00000072-D01P
Species: Hu
Applications: WB
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP1-77189
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IF
NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NBP1-88902
Species: Hu
Applications: IHC, IHC-P
NBP2-23869
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF
NBP1-88905
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86739
Species: Hu
Applications: IHC, IHC-P
NBP2-30505
Species: Hu
Applications: IHC, IHC-P
NBP2-14327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-68135
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00005998-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for ATP10B Antibody (NBP1-90840) (0)

There are no publications for ATP10B Antibody (NBP1-90840).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP10B Antibody (NBP1-90840) (0)

There are no reviews for ATP10B Antibody (NBP1-90840). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP10B Antibody (NBP1-90840) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP10B Products

ATP10B NBP1-90840

Bioinformatics Tool for ATP10B Antibody (NBP1-90840)

Discover related pathways, diseases and genes to ATP10B Antibody (NBP1-90840). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP10B Antibody (NBP1-90840)

Discover more about diseases related to ATP10B Antibody (NBP1-90840).
 

Pathways for ATP10B Antibody (NBP1-90840)

View related products by pathway.

Blogs on ATP10B

There are no specific blogs for ATP10B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP10B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP10B