Recombinant Human ATP synthase C mature GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ATP synthase C mature Protein [H00000516-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human ATP synthase C mature GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 18-136 of Human ATP5G1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ATP5MC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
38.83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP synthase C mature GST (N-Term) Protein

  • ATP synthase C mature
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9)
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
  • ATP5A
  • ATP5G
  • ATP5G1
  • ATP5MC1
  • ATPase protein 9
  • ATPase subunit 9
  • ATPase subunit c
  • H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9)
  • isoform 1
  • mitochondrial ATP synthase, subunit 9
  • mitochondrial ATP synthase, subunit C
  • mitochondrial

Background

ATP5G1( AAH04963, 18 a.a. - 137 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000514-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-47582
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NB100-64792
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP1-87408
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-97838
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-84847
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-62583
Species: Hu
Applications: WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
H00000516-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for ATP synthase C mature Recombinant Protein (H00000516-P01) (0)

There are no publications for ATP synthase C mature Recombinant Protein (H00000516-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP synthase C mature Recombinant Protein (H00000516-P01) (0)

There are no reviews for ATP synthase C mature Recombinant Protein (H00000516-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP synthase C mature Recombinant Protein (H00000516-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP synthase C mature Products

Blogs on ATP synthase C mature.

Mitochondrial ATPase inhibitory factor 1 (IF1) provides an explanation of cancer growth in anoxia or pseudo-anoxia
By Jamshed Arslan Pharm.D. Adenosine triphosphate (ATP) is the major life’s energy-carrying molecule. It is mainly produced by mitochondrial ATP synthase (Complex V) through oxidative phosphorylation (Oxphos)....  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP synthase C mature GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5MC1