ATOH7 Antibody (2B6) - Azide and BSA Free

Western Blot: ATOH7 Antibody (2B6) [H00220202-M03] - Detection against Immunogen (31.06 KDa)

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2B6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATOH7 Antibody (2B6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ATOH7 Antibody (2B6) - Azide and BSA Free (H00220202-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ATOH7 (NP_660161, 53 a.a. ~ 99 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEA
• Specificity: ATOH7 (2B6)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATOH7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATOH7 Antibody (2B6) - Azide and BSA Free

• ATH5
• atonal homolog 7 (Drosophila)
• BHLHA13
• bHLHa13protein atonal homolog 7
• Class A basic helix-loop-helix protein 13
• hATH5
• Helix-loop-helix protein hATH-5
• Math5

Background

ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila 'atonal,' a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATOH7
• Entrez:
  • 220202(Human)
• OMIM:
  • 609875(Human)
• Uniprot:
  • NP_660161(Human)