ATF6 beta Antibody

Images

 
Western Blot: ATF6 beta Antibody [NBP1-91687] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
Western Blot: ATF6 beta Antibody [NBP1-91687] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATF6 beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQR
Specificity
Specificity of human, mouse, rat ATF6 beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATF6B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATF6 beta Protein (NBP1-91687PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATF6 beta Antibody

  • activating transcription factor 6 betacAMP-dependent transcription factor ATF-6 beta
  • ATF6-beta
  • cAMP response element-binding protein-related protein
  • cAMP responsive element binding protein-like 1
  • CREBL1CREB-RP
  • Creb-related protein
  • Creb-rp
  • cyclic AMP-dependent transcription factor ATF-6 beta
  • FLJ10066
  • G13cAMP-responsive element-binding protein-like 1
  • Protein G13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25159
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33955
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-40256
Species: Hu, Mu, Rt, Po, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-83304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ATF6 beta Antibody (NBP1-91687) (0)

There are no publications for ATF6 beta Antibody (NBP1-91687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATF6 beta Antibody (NBP1-91687) (0)

There are no reviews for ATF6 beta Antibody (NBP1-91687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATF6 beta Antibody (NBP1-91687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATF6 beta Products

Bioinformatics Tool for ATF6 beta Antibody (NBP1-91687)

Discover related pathways, diseases and genes to ATF6 beta Antibody (NBP1-91687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF6 beta Antibody (NBP1-91687)

Discover more about diseases related to ATF6 beta Antibody (NBP1-91687).
 

Pathways for ATF6 beta Antibody (NBP1-91687)

View related products by pathway.

PTMs for ATF6 beta Antibody (NBP1-91687)

Learn more about PTMs related to ATF6 beta Antibody (NBP1-91687).

Blogs on ATF6 beta

There are no specific blogs for ATF6 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATF6 beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF6B