ATF6 beta Antibody

Western Blot: ATF6 beta Antibody [NBP1-91687] - Analysis in human cell line SK-MEL-30 and human cell line PC-3.

Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human testis shows strong nuclear and cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human lymph node shows moderate nuclear positivity in non-germinal center cells.

Product Discontinued

ATF6 beta Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATF6B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control:

  HeLa DTT Treated / Untreated Cell Lysate

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%). Reactivity indentified in Mouse in PMID (29186574)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATF6 beta Antibody

• activating transcription factor 6 betacAMP-dependent transcription factor ATF-6 beta
• ATF6-beta
• cAMP response element-binding protein-related protein
• cAMP responsive element binding protein-like 1
• CREBL1CREB-RP
• Creb-related protein
• Creb-rp
• cyclic AMP-dependent transcription factor ATF-6 beta
• FLJ10066
• G13cAMP-responsive element-binding protein-like 1
• Protein G13

Background

ATF-6 is a member of the basic-leucine zipper family of transcription factors. Endoplasmic reticulum stress causes cleavage of transmembrane ATF-6 and transclocation of active ATF-6 to the nucleus. Soluble ATF-6 can exist as either an ATF-6beta homodimer or an ATF-6alpha/beta heterodimer. Binding of the ATF-6beta homodimer or ATF-6alpha/beta heterodimer to the nuclear transcription factor Y C (NF-YC) induces ER chaperone transcription. Human ATF-6beta maps to 1q22-q23 gene locus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATF6 beta Antibody (NBP1-91687)(2)

Publications using NBP1-91687

• Wadgaonkar P, Bi Z, Wan J et al. Arsenic Activates the ER Stress-Associated Unfolded Protein Response via the Activating Transcription Factor 6 in Human Bronchial Epithelial Cells Biomedicines 2022-04-22 [PMID: 35625704] (IHC-P, Human)
• Pappas SS, Liang CC, Kim S et al. TorsinA dysfunction causes persistent neuronal nuclear pore defects. Hum. Mol. Genet. 2018-02-01 [PMID: 29186574] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: ATF6B