ATCAY Antibody

Images

 
Western Blot: ATCAY Antibody [NBP1-74085] - ACHN Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATCAY Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of ATCAY. Immunizing peptide sequence LIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVEN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATCAY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ATCAY and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATCAY Antibody

  • Ataxia cayman type protein
  • ataxia, cerebellar, Cayman type
  • BNIP-H
  • caytaxin
  • CLAC
  • KIAA1872Cayman ataxia

Background

This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4317
Species: Hu
Applications: WB
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7670
Species: Hu
Applications: WB, ICC
NBP1-00175
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-47836
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-14870
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
AF4937
Species: Hu
Applications: WB, IHC
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP2-01702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74085
Species: Hu
Applications: WB

Publications for ATCAY Antibody (NBP1-74085) (0)

There are no publications for ATCAY Antibody (NBP1-74085).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATCAY Antibody (NBP1-74085) (0)

There are no reviews for ATCAY Antibody (NBP1-74085). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATCAY Antibody (NBP1-74085) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATCAY Products

ATCAY NBP1-74085

Bioinformatics Tool for ATCAY Antibody (NBP1-74085)

Discover related pathways, diseases and genes to ATCAY Antibody (NBP1-74085). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATCAY Antibody (NBP1-74085)

Discover more about diseases related to ATCAY Antibody (NBP1-74085).
 

Pathways for ATCAY Antibody (NBP1-74085)

View related products by pathway.

PTMs for ATCAY Antibody (NBP1-74085)

Learn more about PTMs related to ATCAY Antibody (NBP1-74085).

Blogs on ATCAY

There are no specific blogs for ATCAY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATCAY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATCAY
Uniprot