ATCAY Antibody


Western Blot: ATCAY Antibody [NBP1-74085] - ACHN Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ATCAY Antibody Summary

Synthetic peptides corresponding to the C terminal of ATCAY. Immunizing peptide sequence LIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVEN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ATCAY and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATCAY Antibody

  • Ataxia cayman type protein
  • ataxia, cerebellar, Cayman type
  • BNIP-H
  • caytaxin
  • CLAC
  • KIAA1872Cayman ataxia


This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for ATCAY Antibody (NBP1-74085) (0)

There are no publications for ATCAY Antibody (NBP1-74085).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATCAY Antibody (NBP1-74085) (0)

There are no reviews for ATCAY Antibody (NBP1-74085). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATCAY Antibody (NBP1-74085) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ATCAY Products

ATCAY NBP1-74085

Bioinformatics Tool for ATCAY Antibody (NBP1-74085)

Discover related pathways, diseases and genes to ATCAY Antibody (NBP1-74085). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATCAY Antibody (NBP1-74085)

Discover more about diseases related to ATCAY Antibody (NBP1-74085).

Pathways for ATCAY Antibody (NBP1-74085)

View related products by pathway.

PTMs for ATCAY Antibody (NBP1-74085)

Learn more about PTMs related to ATCAY Antibody (NBP1-74085).

Blogs on ATCAY

There are no specific blogs for ATCAY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATCAY Antibody and receive a gift card or discount.


Gene Symbol ATCAY