ASXL2 Recombinant Protein Antigen

Images

 
There are currently no images for ASXL2 Recombinant Protein Antigen (NBP2-58342PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ASXL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASXL2.

Source: E. coli

Amino Acid Sequence: NATGESSSSKEDDTDEESTGDEQESVTVKEEPQVSQSAGKGDTSSGPHSRETLSTSDCLASKNVKAEIPLNEQTTLSKENYLFTRGQTFDEKTLAR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASXL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58342.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ASXL2 Recombinant Protein Antigen

  • additional sex combs like 2 (Drosophila)
  • Additional sex combs-like protein 2
  • ASXH2polycomb group protein ASXH2
  • FLJ10898
  • KIAA1685DKFZp686C1968
  • putative Polycomb group protein ASXL2

Background

The gene that encodes Additional sex combs-like protein 2 (ASXL2) is a homolog of the drosophila additional sex combs (Asx) gene. Drosophila Asx is in a class of proteins known as ETP (enhancers of trithorax and polycomb). ETP proteins regulate polycomb-group (PcG) and trithorax-group (trxG) proteins which function to modify the methylation of histones and structure of chromatin. Mutations in ASXL1 are implicated in the development of myelodysplastic syndromes (MDS), a group of hematological diseases characterized by ineffective hematopoiesis and a predisposition to acute myeloid leukemia (AML). Alternate names for ASXL2 include ASXH2 and KIAA1685.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-57586
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC,  IHC-P, KD, WB
NBP2-55877
Species: Hu
Applications: IHC,  IHC-P
NB300-576
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-76491
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-68209
Species: Hu
Applications: IP, KD, WB
NBP1-76513
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-32104
Species: Hu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-57508
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF5738
Species: Hu
Applications: ICC, KO, WB

Publications for ASXL2 Recombinant Protein Antigen (NBP2-58342PEP) (0)

There are no publications for ASXL2 Recombinant Protein Antigen (NBP2-58342PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASXL2 Recombinant Protein Antigen (NBP2-58342PEP) (0)

There are no reviews for ASXL2 Recombinant Protein Antigen (NBP2-58342PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ASXL2 Recombinant Protein Antigen (NBP2-58342PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ASXL2 Products

Blogs on ASXL2

There are no specific blogs for ASXL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ASXL2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ASXL2