![Western Blot: ASTN2 Antibody [H00023245-B01P] - Analysis of ASTN2 expression in transfected 293T cell line by ASTN2 polyclonal antibody. Lane 1: ASTN2 transfected lysate(48.4 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ASTN2-Antibody-Western-Blot-H00023245-B01P-img0002.jpg "Western Blot: ASTN2 Antibody [H00023245-B01P] - Analysis of ASTN2 expression in transfected 293T cell line by ASTN2 polyclonal antibody. Lane 1: ASTN2 transfected lysate(48.4 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse ASTN2 Antibody - Azide and BSA Free (H00023245-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | ASTN2 (AAH29272.1, 1 a.a. - 440 a.a.) full-length human protein. MNTLLCKGMFCLLSWEADSRGRLGEYTLQPLSLQTEETTELGSKKELKSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIDDWCRCDLSAFDANGLPNCSPLLQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGEFLSFADDLLSGLGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKIMCEEKMVSMARNTYGESKGR |
| Specificity | ASTN2 - astrotactin 2, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | ASTN2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Western Blot TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RII_AF241NA_Western_Blot_21284.jpg)
![Neutralization TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RII_AF-241-NA_Block_Neutralize_8662.jpg)
![Immunohistochemistry TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RII_AF-241-NA_Immunohistochemistry_9941.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ASTN2 |
| Entrez |
|
| Uniprot |
|
![Western Blot Pappalysin-1/PAPP-A Antibody [Unconjugated]](https://images.novusbio.com/images2/Pappalysin1_AF2487_Western_Blot_20190.jpg)
![Western Blot Pappalysin-1/PAPP-A Antibody [Unconjugated]](https://images.novusbio.com/images/af2487_human-pappalysin-1-papp-a-affinity-purified-polyclonal-ab-western-blot-12122025855412.jpg)
![Western Blot Pappalysin-1/PAPP-A Antibody [Unconjugated]](https://images.novusbio.com/images/af2487_human-pappalysin-1-papp-a-affinity-purified-polyclonal-ab-western-blot-121220258541112.jpg)
![Immunocytochemistry Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Immunocytochemistry_6472.jpg)
![Simple Western Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Simple_Western_18959.jpg)
![Western Blot Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Western_Blot_18960.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")