Aspartate beta hydroxylase Antibody - BSA Free

Immunohistochemistry: Aspartate beta hydroxylase Antibody [NBP3-10339] - Immunohistochemical analysis of myenteric plexus tissue of small intestine at an antibody concentration of 5ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Aspartate beta hydroxylase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Aspartate beta hydroxylase Antibody - BSA Free (NBP3-10339) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Aspartate beta hydroxylase (NP_115857). Peptide sequence PEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQ
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASPH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Aspartate beta hydroxylase Antibody - BSA Free

• AAH
• ASP beta-hydroxylase
• aspartate beta-hydroxylaseA beta H-J-J
• aspartyl/asparaginyl-beta-hydroxylase
• BAH
• cardiac junctin
• CASQ2BP1
• EC 1.14.11.16
• HAAHaspartyl/asparaginyl beta-hydroxylase
• humbug
• JCTN
• junctate
• junctin
• Peptide-aspartate beta-dioxygenase

Background

Aspartate beta hydroxylase is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASPH