Asparaginase Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Asparaginase. Source: E. coli
Amino Acid Sequence: VLVPGTGLAAILRTLPMFHDEEHARARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ASPG |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49617. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Asparaginase Recombinant Protein Antigen
Background
Asparaginase is an enzyme purified from E. coli and Erwinia carotovora. It acts by deaminating extracellular L asparagine, an amino acid that appears to be essential for protein synthesis by some tumour cells which are unable to synthesise asparagine. Asparaginase from Erwinia carotovora is serologically and biochemically distinct from asparaginase from E. coli, although its antineoplastic activity and toxicity is similar. Asparaginase is usually considered to be cell cycle phase nonspecific, but it may block some cells in G1 or S phase. Asparaginase reduces cellular and humoral immunity. E.coli contains two L asparaginase isoenzymes: L asparaginase I, a low affinity enzyme located in the cytoplasm, and L asparaginase II, a high affinity secreted enzyme.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP) (0)
There are no publications for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP) (0)
There are no reviews for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP) (0)
Additional Asparaginase Products
Research Areas for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP)
Find related products by research area.
|
Blogs on Asparaginase