We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Asparaginase Recombinant Protein Antigen

Images

 
There are currently no images for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Asparaginase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Asparaginase.

Source: E. coli

Amino Acid Sequence: VLVPGTGLAAILRTLPMFHDEEHARARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASPG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49617.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Asparaginase Recombinant Protein Antigen

  • AnsA
  • AnsB
  • Asparaginase
  • ASPG
  • C14orf76
  • Colaspase
  • Cytoplasmic asparaginase I
  • L ASNase I
  • L ASNase II
  • L asparaginase 1
  • L asparaginase 2
  • L asparaginase I
  • L asparaginase II precursor
  • L asparaginase II
  • L asparagine amidohydrolase I
  • L asparagine amidohydrolase II

Background

Asparaginase is an enzyme purified from E. coli and Erwinia carotovora. It acts by deaminating extracellular L asparagine, an amino acid that appears to be essential for protein synthesis by some tumour cells which are unable to synthesise asparagine. Asparaginase from Erwinia carotovora is serologically and biochemically distinct from asparaginase from E. coli, although its antineoplastic activity and toxicity is similar. Asparaginase is usually considered to be cell cycle phase nonspecific, but it may block some cells in G1 or S phase. Asparaginase reduces cellular and humoral immunity. E.coli contains two L asparaginase isoenzymes: L asparaginase I, a low affinity enzyme located in the cytoplasm, and L asparaginase II, a high affinity secreted enzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-13891
Species: Hu
Applications: IHC,  IHC-P
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31344
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
664-LI
Species: Hu
Applications: BA
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
H00057152-M06
Species: Hu, Mu
Applications: ELISA, IHC-Fr, IP, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NLS2666
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P
AF4036
Species: Hu
Applications: Simple Western, WB
AF3200
Species: Hu
Applications: IHC, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB
H00004585-M07
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-87444
Species: Hu
Applications:  IHC-P, WB

Publications for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP) (0)

There are no publications for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP) (0)

There are no reviews for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Asparaginase Products

Research Areas for Asparaginase Recombinant Protein Antigen (NBP2-49617PEP)

Find related products by research area.

Blogs on Asparaginase

There are no specific blogs for Asparaginase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Asparaginase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ASPG