Asialoglycoprotein Receptor 2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASGR2. Source: E. coli
Amino Acid Sequence: QSAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCC Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ASGR2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85578. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Asialoglycoprotein Receptor 2 Recombinant Protein Antigen
Background
Asialoglycoprotein Receptor 2 is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of plasma glycoproteins in which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. It is expressed exclusively in hepatic parenchymal cells and calcium is required for ligand binding. Asialoglycoprotein Receptor 2 may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. Asialoglycoprotein Receptor 2 is involved in hepatitis B, hepatitis C, liver cirrhosis, hepatocellular carcinoma, nephropathy, leukemia, urethritis, autoimmune hepatitis, alcoholic liver cirrhosis, and jaundice.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Publications for Asialoglycoprotein Receptor 2 Recombinant Protein Antigen (NBP1-85578PEP) (0)
There are no publications for Asialoglycoprotein Receptor 2 Recombinant Protein Antigen (NBP1-85578PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Asialoglycoprotein Receptor 2 Recombinant Protein Antigen (NBP1-85578PEP) (0)
There are no reviews for Asialoglycoprotein Receptor 2 Recombinant Protein Antigen (NBP1-85578PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Asialoglycoprotein Receptor 2 Recombinant Protein Antigen (NBP1-85578PEP) (0)
Additional Asialoglycoprotein Receptor 2 Products
Research Areas for Asialoglycoprotein Receptor 2 Recombinant Protein Antigen (NBP1-85578PEP)
Find related products by research area.
|
Blogs on Asialoglycoprotein Receptor 2