Asialoglycoprotein Receptor 2 Recombinant Protein Antigen

Images

 
There are currently no images for Asialoglycoprotein Receptor 2 Protein (NBP1-85579PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Asialoglycoprotein Receptor 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASGR2.

Source: E. coli

Amino Acid Sequence: YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASGR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85579.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Asialoglycoprotein Receptor 2 Recombinant Protein Antigen

  • ASGPR 2
  • ASGP-R 2
  • ASGPR2
  • ASGP-R2
  • ASGR2
  • asialoglycoprotein receptor 2
  • CLEC4H2
  • CLEC4H2FLJ60040
  • C-type lectin domain family 4 member H2
  • HBxAg-binding protein
  • HBXBP
  • Hepatic lectin H2
  • HL-2

Background

Asialoglycoprotein Receptor 2 is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of plasma glycoproteins in which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. It is expressed exclusively in hepatic parenchymal cells and calcium is required for ligand binding. Asialoglycoprotein Receptor 2 may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. Asialoglycoprotein Receptor 2 is involved in hepatitis B, hepatitis C, liver cirrhosis, hepatocellular carcinoma, nephropathy, leukemia, urethritis, autoimmune hepatitis, alcoholic liver cirrhosis, and jaundice.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60150
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, WB
AF4254
Species: Hu
Applications: ICC, IHC, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-32767
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-46613
Species: Hu, Mu, Rt, Ze
Applications: ELISA, ICC/IF, IHC, WB
NBP3-46020
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-03891
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-56495
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-19860
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF3635
Species: Mu
Applications: IHC, WB
H00005962-M06
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
NBP1-89319
Species: Hu
Applications: IHC, IHC-P

Publications for Asialoglycoprotein Receptor 2 Protein (NBP1-85579PEP) (0)

There are no publications for Asialoglycoprotein Receptor 2 Protein (NBP1-85579PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Asialoglycoprotein Receptor 2 Protein (NBP1-85579PEP) (0)

There are no reviews for Asialoglycoprotein Receptor 2 Protein (NBP1-85579PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Asialoglycoprotein Receptor 2 Protein (NBP1-85579PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Asialoglycoprotein Receptor 2 Products

Research Areas for Asialoglycoprotein Receptor 2 Protein (NBP1-85579PEP)

Find related products by research area.

Blogs on Asialoglycoprotein Receptor 2

There are no specific blogs for Asialoglycoprotein Receptor 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Asialoglycoprotein Receptor 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ASGR2