ASF1b Antibody

Images

 
Western Blot: ASF1b Antibody [NBP1-52947] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASF1b Antibody Summary

Immunogen
Synthetic peptides corresponding to ASF1B(ASF1 anti-silencing function 1 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of ASF1B. Peptide sequence YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASF1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ASF1B and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ASF1b Antibody

  • ASF1 silencing function 1 homolog B (S. cerevisiae)
  • CCG1-interacting factor A-II
  • CIA-II
  • FLJ10604
  • hAsf1
  • hAsf1b
  • hCIA-II
  • histone chaperone ASF1B
  • silencing function protein 1 homolog B

Background

ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57608
Species: Hu
Applications: WB, ICC/IF
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-83035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NB100-81964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-07993
Species: Hu
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NBP1-52947
Species: Hu
Applications: WB

Publications for ASF1b Antibody (NBP1-52947) (0)

There are no publications for ASF1b Antibody (NBP1-52947).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASF1b Antibody (NBP1-52947) (0)

There are no reviews for ASF1b Antibody (NBP1-52947). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASF1b Antibody (NBP1-52947) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASF1b Products

Bioinformatics Tool for ASF1b Antibody (NBP1-52947)

Discover related pathways, diseases and genes to ASF1b Antibody (NBP1-52947). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASF1b Antibody (NBP1-52947)

Discover more about diseases related to ASF1b Antibody (NBP1-52947).
 

Pathways for ASF1b Antibody (NBP1-52947)

View related products by pathway.

PTMs for ASF1b Antibody (NBP1-52947)

Learn more about PTMs related to ASF1b Antibody (NBP1-52947).

Blogs on ASF1b

There are no specific blogs for ASF1b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASF1b Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASF1B
Uniprot