ART3 Antibody

Images

 
Immunohistochemistry: ART3 Antibody [NBP1-86479] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ART3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FHFYLTRALQLLRKPCEASSKTVVYRTSQGTSFTFGGLNQARFGHFTLAYSAKPQAANDQLTVLSIYTCLGVDIENFLDKESERITLIPLNEVFQVSQEGAGNNLILQSINKTCSHYECAFLGGLKTENCIENLEYFQPIYVYNPGEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ART3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ART3 Protein (NBP1-86479PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ART3 Antibody

  • ADP-ribosyltransferase 3
  • EC 2.4.2.31
  • ecto-ADP-ribosyltransferase 3
  • FLJ26404
  • Mono(ADP-ribosyl)transferase 3
  • mono-ADP-ribosyltransferase
  • NAD(P)(+)--arginine ADP-ribosyltransferase 3
  • TMART

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-65853
Species: Mu
Applications: Flow, IP
H00000420-B01P
Species: Hu
Applications: WB
NBP2-13663
Species: Hu
Applications: IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87282
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB400-129
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-83824
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB3518
Species: Mu
Applications: Flow, CyTOF-ready

Publications for ART3 Antibody (NBP1-86479) (0)

There are no publications for ART3 Antibody (NBP1-86479).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ART3 Antibody (NBP1-86479) (0)

There are no reviews for ART3 Antibody (NBP1-86479). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ART3 Antibody (NBP1-86479) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ART3 Products

Bioinformatics Tool for ART3 Antibody (NBP1-86479)

Discover related pathways, diseases and genes to ART3 Antibody (NBP1-86479). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ART3 Antibody (NBP1-86479)

Discover more about diseases related to ART3 Antibody (NBP1-86479).
 

Pathways for ART3 Antibody (NBP1-86479)

View related products by pathway.

PTMs for ART3 Antibody (NBP1-86479)

Learn more about PTMs related to ART3 Antibody (NBP1-86479).

Blogs on ART3

There are no specific blogs for ART3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ART3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ART3
Entrez
Uniprot