Recombinant Human ARNTL2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ARNTL2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 285-379 of Human ARNTL2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVAIGRLQPYIVPQNSGEINVKPTEFITRFAVNG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARNTL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARNTL2 GST (N-Term) Protein

  • Aryl hydrocarbon receptor nuclear translocator-like protein 2
  • Basic-helix-loop-helix-PAS protein MOP9
  • bHLHe6
  • BMAL2
  • Brain and muscle ARNT-like 2
  • Class E basic helix-loop-helix protein 6
  • CLIF
  • CYCLE-like factor
  • Member of PAS protein 9
  • MOP9
  • PAS domain-containing protein 9
  • PASD9
  • Transcription Factor BMAL2

Background

ARNTL2 - aryl hydrocarbon receptor nuclear translocator-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2288
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NB100-126
Species: Hu, Mu
Applications: ChIP, WB
NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
NB100-125
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
DSE100
Species: Hu
Applications: ELISA
NBP3-12196
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP1-88612
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-00749
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3764
Species: Hu, Mu
Applications: ICC, IHC, WB
NB100-1800
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: CHIP-SEQ, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
NBP1-19613
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86436
Species: Hu
Applications: IHC, IHC-P
NBP1-83837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
664-LI/CF
Species: Hu
Applications: BA
H00056938-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ARNTL2 Partial Recombinant Protein (H00056938-Q01) (0)

There are no publications for ARNTL2 Partial Recombinant Protein (H00056938-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARNTL2 Partial Recombinant Protein (H00056938-Q01) (0)

There are no reviews for ARNTL2 Partial Recombinant Protein (H00056938-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARNTL2 Partial Recombinant Protein (H00056938-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARNTL2 Products

Array H00056938-Q01

Bioinformatics Tool for ARNTL2 Partial Recombinant Protein (H00056938-Q01)

Discover related pathways, diseases and genes to ARNTL2 Partial Recombinant Protein (H00056938-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARNTL2 Partial Recombinant Protein (H00056938-Q01)

Discover more about diseases related to ARNTL2 Partial Recombinant Protein (H00056938-Q01).
 

Pathways for ARNTL2 Partial Recombinant Protein (H00056938-Q01)

View related products by pathway.

Blogs on ARNTL2

There are no specific blogs for ARNTL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMAL1 Antibody
NB100-2288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARNTL2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARNTL2