ARMC2 Antibody

Immunocytochemistry/Immunofluorescence: ARMC2 Antibody [NBP2-58580] - Staining of human cell line SiHa shows localization to nucleus.

Product Discontinued

ARMC2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NATATINNLSYYQVKNSIIQDKKLYIAELLLKLLVSNNMDGILEAVRVFGNLSQDHDVCDFIVQNNVHRFMMALLDAQHQDICFSACGVLLNLTVDK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARMC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARMC2 Antibody

• armadillo repeat containing 2
• armadillo repeat-containing protein 2
• bA787I22.1
• DKFZp434P0714
• RP11-787I22.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARMC2