Novus Biologicals products are now on bio-techne.com

ARL5A Antibody (1F12-1A6)

Images

 
Western Blot: ARL5A Antibody (1F12-1A6) [H00026225-M01] - Detection against Immunogen (45.43 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F12-1A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARL5A Antibody (1F12-1A6) Summary

Immunogen
ARL5 (AAH01254, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR
Specificity
ARL5A - ADP-ribosylation factor-like 5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARL5A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARL5A Antibody (1F12-1A6)

  • ADP-ribosylation factor-like 5
  • ADP-ribosylation factor-like 5A
  • ADP-ribosylation factor-like protein 5A
  • ARFLP5
  • ARL5ADP-ribosylation factor-like protein 5

Background

The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-01669
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00009266-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
NBP1-49643
Species: Bv, Hu, Pm, Mu
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KO, WB
NBP2-41263
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-89102
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00009214-M01
Species: Hu, Mu
Applications: ELISA, Flow, IHC, WB
NBP1-80789
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-15461
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-511
Species: Hu, Mu
Applications: IP, WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB8224
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
MAB5457
Species: Hu, Mu, Rt
Applications: WB
NBP2-45925
Species: Ca, Hu, Mu
Applications: ICC/IF, IF, WB
H00053916-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NB110-57586
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC, IHC-P, KD, WB
NB100-56355
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for ARL5A Antibody (H00026225-M01) (0)

There are no publications for ARL5A Antibody (H00026225-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL5A Antibody (H00026225-M01) (0)

There are no reviews for ARL5A Antibody (H00026225-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL5A Antibody (H00026225-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARL5A Products

Research Areas for ARL5A Antibody (H00026225-M01)

Find related products by research area.

Blogs on ARL5A

There are no specific blogs for ARL5A, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL5A Antibody (1F12-1A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL5A
Entrez
OMIM
Uniprot