ARHGEF10L Antibody

Images

 
Western Blot: ARHGEF10L Antibody [NBP2-87032] - Host: Rabbit. Target Name: ARHGEF10L. Sample Tissue: 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGEF10L Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human ARHGEF10L. Peptide sequence: SILAPDILRSDQEEAEGPRAEEDKPDGQAHEPMPDSHVGRELTRKKGILL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF10L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGEF10L Antibody

  • FLJ10521
  • GRINCHGEF
  • KIAA1626
  • Rho guanine nucleotide exchange factor (GEF) 10-like
  • rho guanine nucleotide exchange factor 10-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-83373
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77314
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-02082
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-40619
Species: Hu, Mu
Applications: IHC, IHC-P, IP (-), WB
NBP1-33639
Species: Hu
Applications: IHC, IHC-P
H00353238-B01P-50ug
Species: Hu
Applications: WB
NBP2-87032
Species: Hu
Applications: WB

Publications for ARHGEF10L Antibody (NBP2-87032) (0)

There are no publications for ARHGEF10L Antibody (NBP2-87032).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF10L Antibody (NBP2-87032) (0)

There are no reviews for ARHGEF10L Antibody (NBP2-87032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGEF10L Antibody (NBP2-87032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF10L Products

Bioinformatics Tool for ARHGEF10L Antibody (NBP2-87032)

Discover related pathways, diseases and genes to ARHGEF10L Antibody (NBP2-87032). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF10L Antibody (NBP2-87032)

Discover more about diseases related to ARHGEF10L Antibody (NBP2-87032).
 

Pathways for ARHGEF10L Antibody (NBP2-87032)

View related products by pathway.

Research Areas for ARHGEF10L Antibody (NBP2-87032)

Find related products by research area.

Blogs on ARHGEF10L

There are no specific blogs for ARHGEF10L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF10L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF10L