ARHGEF10L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARHGEF10L Antibody [NBP1-90432] - Immunofluorescent staining of human cell line Hep G2 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: ARHGEF10L Antibody [NBP1-90432] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGEF10L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQNKVYL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF10L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARHGEF10L Protein (NBP1-90432PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGEF10L Antibody

  • FLJ10521
  • GRINCHGEF
  • KIAA1626
  • Rho guanine nucleotide exchange factor (GEF) 10-like
  • rho guanine nucleotide exchange factor 10-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83373
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77314
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-02082
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-40619
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NBP2-13230
Species: Hu
Applications: IHC, IHC-P
H00353238-R01
Species: Hu
NBP1-90432
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for ARHGEF10L Antibody (NBP1-90432) (0)

There are no publications for ARHGEF10L Antibody (NBP1-90432).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF10L Antibody (NBP1-90432) (0)

There are no reviews for ARHGEF10L Antibody (NBP1-90432). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARHGEF10L Antibody (NBP1-90432) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF10L Products

Bioinformatics Tool for ARHGEF10L Antibody (NBP1-90432)

Discover related pathways, diseases and genes to ARHGEF10L Antibody (NBP1-90432). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF10L Antibody (NBP1-90432)

Discover more about diseases related to ARHGEF10L Antibody (NBP1-90432).
 

Pathways for ARHGEF10L Antibody (NBP1-90432)

View related products by pathway.

Blogs on ARHGEF10L

There are no specific blogs for ARHGEF10L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF10L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF10L