ARHGEF1 Antibody (4C4)

Images

 
Western Blot: ARHGEF1 Antibody (4C4) [H00009138-M03] - Analysis of ARHGEF1 expression in K-562 (Cat # L009V1).
Immunocytochemistry/ Immunofluorescence: ARHGEF1 Antibody (4C4) [H00009138-M03] - Analysis of monoclonal antibody to ARHGEF1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: ARHGEF1 Antibody (4C4) [H00009138-M03] - Detection limit for recombinant GST tagged ARHGEF1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
4C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARHGEF1 Antibody (4C4) Summary

Immunogen
ARHGEF1 (AAH34013.2, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT
Specificity
ARHGEF1 (4C4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARHGEF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Control
ARHGEF1 Knockout 293T Cell Lysate
Publications
Read Publication using H00009138-M03.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARHGEF1 Antibody (4C4)

  • 115 kDa guanine nucleotide exchange factor
  • 115-kD protein
  • GEF1
  • LBCL2LSC
  • Lsc homolog
  • p115RhoGEF
  • P115-RHOGEF
  • Rho guanine nucleotide exchange factor (GEF) 1
  • rho guanine nucleotide exchange factor 1
  • SUB1.5

Background

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
AF4737
Species: Hu
Applications: WB
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-95233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP2-24517
Species: Hu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-32728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00009138-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for ARHGEF1 Antibody (H00009138-M03)(1)

Reviews for ARHGEF1 Antibody (H00009138-M03) (0)

There are no reviews for ARHGEF1 Antibody (H00009138-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARHGEF1 Antibody (H00009138-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARHGEF1 Products

Bioinformatics Tool for ARHGEF1 Antibody (H00009138-M03)

Discover related pathways, diseases and genes to ARHGEF1 Antibody (H00009138-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF1 Antibody (H00009138-M03)

Discover more about diseases related to ARHGEF1 Antibody (H00009138-M03).
 

Pathways for ARHGEF1 Antibody (H00009138-M03)

View related products by pathway.

PTMs for ARHGEF1 Antibody (H00009138-M03)

Learn more about PTMs related to ARHGEF1 Antibody (H00009138-M03).
 

Research Areas for ARHGEF1 Antibody (H00009138-M03)

Find related products by research area.

Blogs on ARHGEF1

There are no specific blogs for ARHGEF1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF1 Antibody (4C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF1
Entrez
OMIM
Uniprot