Home » ARHGEF1 » ARHGEF1 Research Products » ARHGEF1 Antibody (4C4)

ARHGEF1 Antibody (4C4)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ARHGEF1 Antibody (4C4) [H00009138-M03] - Analysis of ARHGEF1 expression in K-562 (Cat # L009V1).
Western Blot: ARHGEF1 Antibody (4C4) [H00009138-M03] - Analysis of ARHGEF1 expression in K-562 (Cat # L009V1).
Immunocytochemistry/ Immunofluorescence: ARHGEF1 Antibody (4C4) [H00009138-M03] - Analysis of monoclonal antibody to ARHGEF1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: ARHGEF1 Antibody (4C4) [H00009138-M03] - Detection limit for recombinant GST tagged ARHGEF1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
4C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ARHGEF1 Antibody (4C4) Summary

Immunogen
ARHGEF1 (AAH34013.2, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT
Specificity
ARHGEF1 (4C4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARHGEF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Control
ARHGEF1 Knockout 293T Cell Lysate
Publications
Read Publication using H00009138-M03.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARHGEF1 Antibody (4C4)

  • 115 kDa guanine nucleotide exchange factor
  • 115-kD protein
  • GEF1
  • LBCL2LSC
  • Lsc homolog
  • p115RhoGEF
  • P115-RHOGEF
  • Rho guanine nucleotide exchange factor (GEF) 1
  • rho guanine nucleotide exchange factor 1
  • SUB1.5

Background

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RhoD Antibody
NBP1-58359
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Expos
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
Rhodopsin Antibody
(1D4)
NBP1-47602
Western Blot: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis of Human Cell lysates showing detection of Rhodopsin protein using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Dull epidermal staining.
(3 Publications)
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
RhoA Antibody
NB100-91273
Western Blot: RhoA Antibody [NB100-91273] - Rat spinal cord lysate using Rabbit antibody to Transforming protein RhoA: whole serum at 1:2000 dilution. One single band is detected.
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
Immunohistochemistry: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin sections) using Rabbit antibody to RhoA at a concentration of 15 ug/ml, incubated overnight and developed with DAB Ni.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
GEF-H1 Antibody
NBP2-21577
Western Blot: GEF-H1 Antibody [NBP2-21577] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with GEF-H1 antibody diluted at 1:4000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: GEF-H1 Antibody [NBP2-21577] - GEF-H1 antibody detects GEF-H1 protein at cytoskeleton and Golgi apparatus by immunofluorescent analysis. Sample: HeLa cells were fixed in ice-cold MeOH for 5 min. Green: GEF-H1 stained by GEF-H1 antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar= 10 um.
Immunohistochemistry-Paraffin: GEF-H1 Antibody [NBP2-21577] - GEF-H1 antibody detects GEF-H1 protein at cytoplasm by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. GEF-H1 stained by GEF-H1 antibody diluted at 1:1000. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
LARG Antibody
AF4737
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Human LARG Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4737) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for LARG at approximately 200 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.
Species: Hu
Applications: WB
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot: SLC2A4RG Antibody (4C10) [H00056731-M02] - SLC2A4RG monoclonal antibody (M02), clone 4C10 Analysis of SLC2A4RG expression in HeLa.
Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody (4C10) [H00056731-M02] - Analysis of monoclonal antibody to SLC2A4RG on HeLa cell. Antibody concentration 10 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF
RASGRF1 Antibody
NBP2-95233
Western Blot: RASGRF1 Antibody [NBP2-95233] - Analysis of extracts of mouse brain, using RASGRF1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure tim
Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP2-95233] - Analysis of U2OS cells using RASGRF1. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP2-95233] - Paraffin-embedded human stomach using RASGRF1.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
SOS1 Antibody
(SOS-01)
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: WB, ICC/IF
SOS2 Antibody
[Unconjugated]
AF6260
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and 293T human embryonic kidney cell line. PVDF Membrane was probed with 2 µg/mL of Goat Anti-Human SOS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6260) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for SOS2 at approximately 160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
ARHGEF11 Antibody
NBP2-24517
Western Blot: ARHGEF11 Antibody [NBP2-24517] - Analysis of human ARHGEF11 in rat brain lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24517 at 0.1 ug/ml.
Immunohistochemistry-Paraffin: ARHGEF11 Antibody [NBP2-24517] - IHC analysis of human skin using NBP2-24517 at 10 ug/ml.
(1 Publication)
Species: Hu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Recombinant Human
Blood group H inhibit ...
H00002523-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
SUCLG1 Antibody
NBP1-32728
Western Blot: SUCLG1 Antibody [NBP1-32728] - Sample (30 ug of whole cell lysate) A: A431 10% SDS PAGE, antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SUCLG1 Antibody [NBP1-32728] - Sample: HeLa cells were fixed in 2% paraformaldehyde/culture medium at 37C for 30 min. Green: SUCLG1 protein stained by SUCLG1 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-32728] - N87 xenograft, using SUCLG1antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
(21 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
CDC42 Antibody
(JJ086-04)
NBP2-67895
Western Blot: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of CDC42 on different lysates using anti-CDC42 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: Jurkat Lane 3: HepG2
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded mouse pancreas tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Flow Cytometry: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of Hela cells with CDC42 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
ARHGEF1 Antibody
(4C4)
H00009138-M03
ARHGEF1 Antibody (4C4)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for ARHGEF1 Antibody (H00009138-M03)(1)


Reviews for ARHGEF1 Antibody (H00009138-M03) (0)

There are no reviews for ARHGEF1 Antibody (H00009138-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARHGEF1 Antibody (H00009138-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

ARHGEF1 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ARHGEF1 Products

Bioinformatics Tool for ARHGEF1 Antibody (H00009138-M03)

Discover related pathways, diseases and genes to ARHGEF1 Antibody (H00009138-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF1 Antibody (H00009138-M03)

Discover more about diseases related to ARHGEF1 Antibody (H00009138-M03).
 

Pathways for ARHGEF1 Antibody (H00009138-M03)

View related products by pathway.

PTMs for ARHGEF1 Antibody (H00009138-M03)

Learn more about PTMs related to ARHGEF1 Antibody (H00009138-M03).
 

Research Areas for ARHGEF1 Antibody (H00009138-M03)

Find related products by research area.

Blogs on ARHGEF1

There are no specific blogs for ARHGEF1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF1 Antibody (4C4) and receive a gift card or discount.


Bioinformatics

Gene Symbol ARHGEF1
Entrez
OMIM
Uniprot