ARHGAP27 Antibody

Images

 
Western Blot: ARHGAP27 Antibody [NBP2-55668] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: ARHGAP27 Antibody [NBP2-55668] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP27 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRSIHKSSQDGDTPAQASPPEEKVPAELDEVGSWEEVSPATAAVRTKTLDKAGVLHRTKTADKGKRLRKEHWSAS
Specificity
Specificity of human ARHGAP27 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP27
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ARHGAP27 Antibody

  • Rho GTPase activating protein 27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85614
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91678
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83870
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-57680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000395-M01
Species: Hu
Applications: WB, ELISA
NBP1-06499
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-20158
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-49292
Species: Hu
Applications: IHC, IHC-P
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P

Publications for ARHGAP27 Antibody (NBP2-55668) (0)

There are no publications for ARHGAP27 Antibody (NBP2-55668).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP27 Antibody (NBP2-55668) (0)

There are no reviews for ARHGAP27 Antibody (NBP2-55668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARHGAP27 Antibody (NBP2-55668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARHGAP27 Products

Bioinformatics Tool for ARHGAP27 Antibody (NBP2-55668)

Discover related pathways, diseases and genes to ARHGAP27 Antibody (NBP2-55668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP27 Antibody (NBP2-55668)

Discover more about diseases related to ARHGAP27 Antibody (NBP2-55668).
 

Pathways for ARHGAP27 Antibody (NBP2-55668)

View related products by pathway.

PTMs for ARHGAP27 Antibody (NBP2-55668)

Learn more about PTMs related to ARHGAP27 Antibody (NBP2-55668).

Blogs on ARHGAP27

There are no specific blogs for ARHGAP27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP27