Recombinant Human ARHGAP1 Protein

Images

 
SDS-Page: Recombinant Human ARHGAP1 Protein [H00000392-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARHGAP1 Protein Summary

Description
ARHGAP1 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARHGAP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARHGAP1 Protein

  • ARHGAP1
  • CDC42 GTPase-activating protein
  • CDC42GAP
  • CDC42GAPp50-RhoGAP
  • GTPase-activating protein rhoOGAP
  • p50rhoGAP
  • Rho GTPase activating protein 1
  • rho GTPase-activating protein 1
  • RhoGAP
  • RHOGAP1Cdc42GAP
  • Rho-related small GTPase protein activator
  • Rho-type GTPase-activating protein 1

Background

ARHGAP1 - Rho GTPase activating protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88559
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-88154
Species: Hu, Mu
Applications: WB, IP, PLA
AF877
Species: Hu
Applications: WB, IHC, IP
NBP2-20158
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF7548
Species: Hu
Applications: IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-57680
Species: Hu
Applications: ICC/IF
H00000392-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ARHGAP1 Partial Recombinant Protein (H00000392-Q01) (0)

There are no publications for ARHGAP1 Partial Recombinant Protein (H00000392-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP1 Partial Recombinant Protein (H00000392-Q01) (0)

There are no reviews for ARHGAP1 Partial Recombinant Protein (H00000392-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGAP1 Partial Recombinant Protein (H00000392-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARHGAP1 Products

Bioinformatics Tool for ARHGAP1 Partial Recombinant Protein (H00000392-Q01)

Discover related pathways, diseases and genes to ARHGAP1 Partial Recombinant Protein (H00000392-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP1 Partial Recombinant Protein (H00000392-Q01)

Discover more about diseases related to ARHGAP1 Partial Recombinant Protein (H00000392-Q01).
 

Pathways for ARHGAP1 Partial Recombinant Protein (H00000392-Q01)

View related products by pathway.

Blogs on ARHGAP1

There are no specific blogs for ARHGAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARHGAP1 Antibody
NBP1-85724
ARHGAP1 Antibody
NBP1-85724
ARHGAP1 Antibody
NBP1-85724

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARHGAP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP1
Entrez