ARHGAP1 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

ARHGAP1 Partial Recombinant Protein Summary

Description
ARHGAP1 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL
Gene
ARHGAP1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Western Blot, ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARHGAP1 Partial Recombinant Protein

  • ARHGAP1
  • CDC42 GTPase-activating protein
  • CDC42GAP
  • CDC42GAPp50-RhoGAP
  • GTPase-activating protein rhoOGAP
  • p50rhoGAP
  • Rho GTPase activating protein 1
  • rho GTPase-activating protein 1
  • RhoGAP
  • RHOGAP1Cdc42GAP
  • Rho-related small GTPase protein activator
  • Rho-type GTPase-activating protein 1

Background

ARHGAP1 - Rho GTPase activating protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-45477
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, ICC
MAB2055
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, ICFlow
NB300-917
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88559
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-92688
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF877
Species: Hu
Applications: WB, IHC, IP
MAB3429
Species: Hu
Applications: WB
NBP2-20158
Species: Hu
Applications: WB, IHC, IHC-P
MAB2685
Species: Hu
Applications: WB, Simple Western, ICC
MAB18251
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-90108
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7548
Species: Hu
Applications: IHC
NBP2-41160
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP

Publications for ARHGAP1 Partial Recombinant Protein (H00000392-Q01) (0)

There are no publications for ARHGAP1 Partial Recombinant Protein (H00000392-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP1 Partial Recombinant Protein (H00000392-Q01) (0)

There are no reviews for ARHGAP1 Partial Recombinant Protein (H00000392-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGAP1 Partial Recombinant Protein (H00000392-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARHGAP1 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for ARHGAP1 Partial Recombinant Protein (H00000392-Q01)

Discover related pathways, diseases and genes to ARHGAP1 Partial Recombinant Protein (H00000392-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP1 Partial Recombinant Protein (H00000392-Q01)

Discover more about diseases related to ARHGAP1 Partial Recombinant Protein (H00000392-Q01).
 

Pathways for ARHGAP1 Partial Recombinant Protein (H00000392-Q01)

View related products by pathway.

Blogs on ARHGAP1

There are no specific blogs for ARHGAP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ARHGAP1
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00000392-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

ARHGAP1 Antibody
NBP1-85724
ARHGAP1 Antibody
NBP1-85724
ARHGAP1 Antibody
NBP1-85724