ARGFX Antibody

Images

 
Immunohistochemistry-Paraffin: ARGFX Antibody [NBP2-14307] - Staining of human testis shows moderate membranous positivity in subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARGFX Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVPALYSDAYDISQIIELYNLPDENEISSSSFHCLYQYLSLTKYQVGGQG SSLSIFAGPAVGLSPAQTWPNM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARGFX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARGFX Protein (NBP2-14307PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARGFX Antibody

  • arginine-fifty homeobox

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
H00005013-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-92524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91847
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-32452
Species: Hu
Applications: IHC, IHC-P
NB120-6102
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP2-53210
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PAGE

Publications for ARGFX Antibody (NBP2-14307) (0)

There are no publications for ARGFX Antibody (NBP2-14307).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARGFX Antibody (NBP2-14307) (0)

There are no reviews for ARGFX Antibody (NBP2-14307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARGFX Antibody (NBP2-14307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARGFX Products

Bioinformatics Tool for ARGFX Antibody (NBP2-14307)

Discover related pathways, diseases and genes to ARGFX Antibody (NBP2-14307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARGFX Antibody (NBP2-14307)

Discover more about diseases related to ARGFX Antibody (NBP2-14307).
 

Pathways for ARGFX Antibody (NBP2-14307)

View related products by pathway.

Blogs on ARGFX

There are no specific blogs for ARGFX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARGFX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARGFX
Entrez
Uniprot