DUXA Antibody

Images

 
Immunohistochemistry-Paraffin: DUXA Antibody [NBP2-32452] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DUXA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAEDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUXA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DUXA Protein (NBP2-32452PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DUXA Antibody

  • double homeobox A
  • double homeobox protein A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49552
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-92524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91847
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14307
Species: Hu
Applications: IHC, IHC-P
NBP2-32452
Species: Hu
Applications: IHC, IHC-P

Publications for DUXA Antibody (NBP2-32452) (0)

There are no publications for DUXA Antibody (NBP2-32452).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUXA Antibody (NBP2-32452) (0)

There are no reviews for DUXA Antibody (NBP2-32452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DUXA Antibody (NBP2-32452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUXA Products

DUXA NBP2-32452

Bioinformatics Tool for DUXA Antibody (NBP2-32452)

Discover related pathways, diseases and genes to DUXA Antibody (NBP2-32452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUXA Antibody (NBP2-32452)

Discover more about diseases related to DUXA Antibody (NBP2-32452).
 

Pathways for DUXA Antibody (NBP2-32452)

View related products by pathway.

Blogs on DUXA

There are no specific blogs for DUXA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUXA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUXA