ARFIP2 Antibody (2B5)

Images

 
Western Blot: ARFIP2 Antibody (2B5) [H00023647-M01] - ARFIP2 monoclonal antibody (M01), clone 2B5 Analysis of ARFIP2 expression in IMR-32.
Sandwich ELISA: ARFIP2 Antibody (2B5) [H00023647-M01] - Detection limit for recombinant GST tagged ARFIP2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
2B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARFIP2 Antibody (2B5) Summary

Immunogen
ARFIP2 (AAH00392, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQL
Localization
Cytoplasmic
Specificity
ARFIP2 - ADP-ribosylation factor interacting protein 2 (arfaptin 2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARFIP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Control
ARFIP2 Knockout HeLa Cell Lysate
Publications
Read Publications using H00023647-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARFIP2 Antibody (2B5)

  • ADP-ribosylation factor interacting protein 2
  • ADP-ribosylation factor-interacting protein 2
  • arfaptin 2
  • arfaptin-2
  • Partner of RAC1
  • POR1partner of RAC1 (arfaptin 2)
  • Protein POR1

Background

ARFIP2 is a ubiquitously expressed protein implicated in mediating cross talk between RAC and ARF small GTPases. It has been shown that ARFIP2 binds specifically to GTP-bound ARF1 and ARF6, but binds to Rac-GTP and Rac-GDP with similar affinities. The X-ray structure of arfaptin reveals an elongated, crescent-shaped dimer of 3-helix coiled-coils. Structures of arfaptin with Rac bound to either GDP or the slowly hydrolysable analog GMPPNP show that the switch regions adopt similar conformations in both complexes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-39002
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-695
Species: Hu, Mu, Rt, Bv, Fi
Applications: WB, ELISA, IHC, KD
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-15461
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-996
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-87561
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58310
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-61710
Species: Hu, Rt
Applications: WB, ELISA, Flow
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-82131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00023647-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for ARFIP2 Antibody (H00023647-M01)(2)

Reviews for ARFIP2 Antibody (H00023647-M01) (0)

There are no reviews for ARFIP2 Antibody (H00023647-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARFIP2 Antibody (H00023647-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARFIP2 Products

Bioinformatics Tool for ARFIP2 Antibody (H00023647-M01)

Discover related pathways, diseases and genes to ARFIP2 Antibody (H00023647-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARFIP2 Antibody (H00023647-M01)

Discover more about diseases related to ARFIP2 Antibody (H00023647-M01).
 

Pathways for ARFIP2 Antibody (H00023647-M01)

View related products by pathway.

PTMs for ARFIP2 Antibody (H00023647-M01)

Learn more about PTMs related to ARFIP2 Antibody (H00023647-M01).
 

Research Areas for ARFIP2 Antibody (H00023647-M01)

Find related products by research area.

Blogs on ARFIP2

There are no specific blogs for ARFIP2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARFIP2 Antibody (2B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARFIP2
Entrez
OMIM
Uniprot