Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen | Synthetic peptides corresponding to ARF1(ADP-ribosylation factor 1) The peptide sequence was selected from the middle region of ARF1. Peptide sequence MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ARF1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Control |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ARF1 Antibody (NBP1-58941)Find related products by research area.
|
Arf1: A New Focus In Cancer Drug Therapy ARF1 (ADP-ribosylation factor 1) is a protein in the ARF gene family that is responsible for vesicular trafficking within the cell through its activation of phospholipase D. It is found in the cells golgi apparatus and its main function is intra-Golgi... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.