ARF1 Antibody


Western Blot: ARF1 Antibody [NBP1-58941] - Middle region validated by WB using Fetal lung Lysate at 0.2-1 ug/ml.
Immunohistochemistry-Paraffin: ARF1 Antibody [NBP1-58941] - Mouse brain stem cells, 2 ug/ml.
Western Blot: ARF1 Antibody [NBP1-58941] - Human Fetal lung Lysate, concentration 0.2-1 ug/ml.
Western Blot: ARF1 Antibody [NBP1-58941] - Rat brain homogenate at 1:500.
Western Blot: ARF1 Antibody [NBP1-58941] - Titration: 2 ug/ml Positive Control: Rat brain homogenate

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, IP

Order Details

ARF1 Antibody Summary

Synthetic peptides corresponding to ARF1(ADP-ribosylation factor 1) The peptide sequence was selected from the middle region of ARF1. Peptide sequence MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ARF1 and was validated on Western blot. Although not tested this antibody may be useful in Immunoprecipitation.
Positive Control
Brain Frontal Lobe Lysate (NB820-59379)
ARF1 Lysate (NBP2-64857)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARF1 Antibody

  • ADP-ribosylation factor 1


ADP-ribosylation factor 1 (ARF1) is a member of the human ARF family. The family is composed of small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. These protein, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Mu
Applications: WB (-), WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP

Publications for ARF1 Antibody (NBP1-58941) (0)

There are no publications for ARF1 Antibody (NBP1-58941).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARF1 Antibody (NBP1-58941) (0)

There are no reviews for ARF1 Antibody (NBP1-58941). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARF1 Antibody (NBP1-58941) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional ARF1 Products

Bioinformatics Tool for ARF1 Antibody (NBP1-58941)

Discover related pathways, diseases and genes to ARF1 Antibody (NBP1-58941). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARF1 Antibody (NBP1-58941)

Discover more about diseases related to ARF1 Antibody (NBP1-58941).

Pathways for ARF1 Antibody (NBP1-58941)

View related products by pathway.

PTMs for ARF1 Antibody (NBP1-58941)

Learn more about PTMs related to ARF1 Antibody (NBP1-58941).

Blogs on ARF1.

Arf1: A New Focus In Cancer Drug Therapy
ARF1 (ADP-ribosylation factor 1) is a protein in the ARF gene family that is responsible for vesicular trafficking within the cell through its activation of phospholipase D. It is found in the cells golgi apparatus and its main function is intra-Golgi...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARF1 Antibody and receive a gift card or discount.


Gene Symbol ARF1