Aquaporin-4 Antibody - Azide and BSA Free

Western Blot: Aquaporin-4 Antibody [NBP2-92730] - Analysis of extracts of various cell lines, using Aquaporin-4 .Exposure time: 90s.

Product Discontinued

Aquaporin-4 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 244-323 of human Aquaporin-4 (NP_001641.1). AGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AQP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aquaporin-4 Antibody - Azide and BSA Free

• AQP4
• AQP-4
• Aquaporin 4
• MGC22454
• MIWC
• WCH4

Background

The Aquaporin-4 gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selectivechannels in the plasma membranes of many cells. The encoded protein is the predominant aquaporin found in brain. Twoalternatively spliced tra

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: AQP4