Aquaporin 1/AQP1 Antibody (8V1O3) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 170-269 of human Aquaporin-1 (Aquaporin 1/AQP1) (P29972). LAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
AQP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunocytochemistry/ Immunofluorescence 1:100 - 1:1000
- Immunohistochemistry 1:500 - 1:2000
- Immunohistochemistry-Paraffin 1:500 - 1:2000
- Western Blot 1:1000 - 1:6000
|
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Aquaporin 1/AQP1 Antibody (8V1O3)
Background
Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Thisgene encodes an aquaporin which functions as a molecular water channel protein. It is a homotetramer with 6 bilayerspanning domains and N-glycosylation sites. The protein physically resembles channel proteins and is abundant inerythrocytes and renal tubes. The gene encoding this aquaporin is a possible candidate for disorders involvingimbalance in ocular fluid movement. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Eq, Hu, Mu, Po
Applications: ICC/IF, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Publications for Aquaporin 1/AQP1 Antibody (NBP3-16354) (0)
There are no publications for Aquaporin 1/AQP1 Antibody (NBP3-16354).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Aquaporin 1/AQP1 Antibody (NBP3-16354) (0)
There are no reviews for Aquaporin 1/AQP1 Antibody (NBP3-16354).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Aquaporin 1/AQP1 Antibody (NBP3-16354). (Showing 1 - 1 of 1 FAQ).
-
Are any of your Aquaporin-1 antibodies suitable for live cell staining? I am looking at doing flow cytometry on live cells and further isolation of the positive cells to purify the population.
- A list of our Aquaporin-1 antibodies suitable for use in flow cytometry can be found using this link. Of note, NB600-741 is known to bind to an extracellular domain, so should be suitable for your use.
Secondary Antibodies
| |
Isotype Controls
|
Additional Aquaporin 1/AQP1 Products
Research Areas for Aquaporin 1/AQP1 Antibody (NBP3-16354)
Find related products by research area.
|
Blogs on Aquaporin 1/AQP1