Home » Apolipoprotein M/ApoM » Apolipoprotein M/ApoM Proteins » Recombinant Human Apolipoprotein M/ApoM Protein

Recombinant Human Apolipoprotein M/ApoM Protein

 (3 Publications)
 See All Related
Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related Apolipoprotein M/ApoM Peptides and Proteins

Order Details


    • Catalog Number
      H00055937-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Apolipoprotein M/ApoM Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 23-188 of Human APOM full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
APOM

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publications using H00055937-P01.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Apolipoprotein M/ApoM Protein

  • Apolipoprotein M
  • APOM
  • apo-M
  • G3A
  • HSPC336
  • MGC22400
  • NG20
  • NG20-like protein
  • Protein G3a

Background

APOM( AAH20683, 23 a.a. - 189 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Apolipoprotein
A-I/ApoA1 Antibody - ...
NBP2-52979
Flow Cytometry Apolipoprotein A-I/ApoA1 Antibody - BSA Free
Western Blot Apolipoprotein A-I/ApoA1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Apolipoprotein A-I/ApoA1 Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
LRH-1/NR5A2
Antibody - BSA Free
NBP2-27196
Immunohistochemistry-Paraffin LRH-1/NR5A2 Antibody - BSA Free
Western Blot LRH-1/NR5A2 Antibody - BSA Free
Western Blot LRH-1/NR5A2 Antibody - BSA Free
(1 Publication)
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC,  IHC-P, KD, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(30 Publications)
Species: Bv, Hu, Mu
Applications: ICC, IHC
ABCA1 Antibody -
BSA Free
NB400-105
Dual RNAscope ISH-IHC ABCA1 Antibody - BSA Free
Immunohistochemistry-Paraffin ABCA1 Antibody - BSA Free
Western Blot ABCA1 Antibody - BSA Free
(7 Reviews)
(419 Publications)
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
BAT3/BAG6 Antibody
AF6438
Immunocytochemistry BAT3/BAG6 Antibody
Western Blot BAT3/BAG6 Antibody
Western Blot BAT3/BAG6 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, IHC
HNF1 Antibody -
BSA Free
NBP1-33596
Immunoprecipitation HNF1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence HNF1 Antibody - BSA Free
Western Blot HNF1 Antibody - BSA Free
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PAGE, WB
Transcobalamin II
Antibody
AF7895
Western Blot Transcobalamin II Antibody
Immunohistochemistry Transcobalamin II Antibody
Species: Hu
Applications: IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(840 Publications)
Species: Hu
Applications: BA
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(160 Publications)
Species: Hu
Applications: ELISA
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
Apolipoprotein
A-II/ApoA2 Antibody ( ...
NBP3-16168
Immunohistochemistry Apolipoprotein A-II/ApoA2 Antibody (5F7U1)
Western Blot Apolipoprotein A-II/ApoA2 Antibody (5F7U1)
Immunocytochemistry/ Immunofluorescence Apolipoprotein A-II/ApoA2 Antibody (5F7U1)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
PON1 Antibody
(4G8D3) - Azide and B ...
NBP2-80919
Western Blot PON1 Antibody (4G8D3) - Azide and BSA Free
Western Blot PON1 Antibody (4G8D3) - Azide and BSA Free
Western Blot PON1 Antibody (4G8D3) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF (-), IHC,  IHC-P, WB
LIPC Antibody -
BSA Free
NBP3-46020
Western Blot LIPC Antibody - BSA Free
Immunohistochemistry LIPC Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
LDLR Antibody
[Unconjugated]
AF2255
Immunohistochemistry LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
(51 Publications)
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/ Immunofluorescence c-jun [p Ser63] Antibody (SY0297)
Immunocytochemistry/ Immunofluorescence c-jun [p Ser63] Antibody (SY0297)
Immunohistochemistry-Paraffin c-jun [p Ser63] Antibody (SY0297)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
HNF-4 alpha/NR2A1
Antibody - BSA Free
NBP1-89679
Immunohistochemistry-Frozen HNF-4 alpha/NR2A1 Antibody - BSA Free
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody - BSA Free
Western Blot HNF-4 alpha/NR2A1 Antibody - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
(104 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB

Publications for Apolipoprotein M/ApoM Recombinant Protein (H00055937-P01)(3)


Reviews for Apolipoprotein M/ApoM Recombinant Protein (H00055937-P01) (0)

There are no reviews for Apolipoprotein M/ApoM Recombinant Protein (H00055937-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein M/ApoM Recombinant Protein (H00055937-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein M/ApoM Products

Blogs on Apolipoprotein M/ApoM

There are no specific blogs for Apolipoprotein M/ApoM, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Apolipoprotein M/ApoM Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol APOM