Apolipoprotein M/ApoM Recombinant Protein Antigen

Images

 
There are currently no images for Apolipoprotein M/ApoM Recombinant Protein Antigen (NBP2-48991PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Apolipoprotein M/ApoM Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Apolipoprotein M/ApoM.

Source: E. coli

Amino Acid Sequence: LNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APOM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48991.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Apolipoprotein M/ApoM Recombinant Protein Antigen

  • Apolipoprotein M
  • APOM
  • apo-M
  • G3A
  • HSPC336
  • MGC22400
  • NG20
  • NG20-like protein
  • Protein G3a

Background

Apolipoprotein M is encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Two transcript variants encoding two different isoforms have been found for this gene, but only one of them has been fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3664
Species: Hu
Applications: Simple Western, WB
NBP2-27196
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC,  IHC-P, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
AF6438
Species: Hu, Mu, Rt
Applications: ICC, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PAGE, WB
AF7895
Species: Hu
Applications: IHC, WB
DLP00
Species: Hu
Applications: ELISA
MAB8306
Species: Hu
Applications: IHC, WB
NBP3-16168
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-80919
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF (-), IHC,  IHC-P, WB
NBP3-46020
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
PP-K9218-00
Species: Hu
Applications: IHC, IP, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB

Publications for Apolipoprotein M/ApoM Recombinant Protein Antigen (NBP2-48991PEP) (0)

There are no publications for Apolipoprotein M/ApoM Recombinant Protein Antigen (NBP2-48991PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein M/ApoM Recombinant Protein Antigen (NBP2-48991PEP) (0)

There are no reviews for Apolipoprotein M/ApoM Recombinant Protein Antigen (NBP2-48991PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Apolipoprotein M/ApoM Recombinant Protein Antigen (NBP2-48991PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein M/ApoM Products

Blogs on Apolipoprotein M/ApoM

There are no specific blogs for Apolipoprotein M/ApoM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Apolipoprotein M/ApoM Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol APOM