Apolipoprotein E/ApoE Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Apolipoprotein E/ApoE Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-49565PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Apolipoprotein E/ApoE Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Apolipoprotein E/ApoE.

Source: E. coli

Amino Acid Sequence: QAKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APOE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49565.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Apolipoprotein E/ApoE Recombinant Protein Antigen

  • APOE
  • Apo-E
  • Apolipoprotein E
  • apolipoprotein E3
  • late onset)
  • MGC1571

Background

Apolipoprotein E (APOE) is an apolipoprotein located in chylomicrons and intermediate-density lipoproteins that is necessary for the normal catabolism of triglyceride-rich lipoprotein constituents in the liver. APOE has recently been shown to be involseveral biological processes other than lipoprotein transport, including cognition and immunoregulation.

Lipoproteins are responsible for carrying cholesterol and other fats through the bloodstream as little packages and are essential for the normal breakdown of these molecules. In particular, apolipoprotein E is a major component of specific lipoproteins called very low-density lipoproteins (VLDL). A major function of VLDLs is to remove excess cholesterol from the blood and carry it to the liver for processing. Maintaining normal levels of cholesterol is essential for the prevention of cardiovascular diseases, including heart attacks and strokes.

The three Apo E isoforms are strongly associated with cardiovascular disease and Alzheimer's disease, so ApoE antibodies have become useful tools for research in both of these areas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
H00009354-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-84943
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
AF3664
Species: Hu
Applications: Simple Western, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
MAB8306
Species: Hu
Applications: IHC, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB

Publications for Apolipoprotein E/ApoE Recombinant Protein Antigen (NBP2-49565PEP) (0)

There are no publications for Apolipoprotein E/ApoE Recombinant Protein Antigen (NBP2-49565PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein E/ApoE Recombinant Protein Antigen (NBP2-49565PEP) (0)

There are no reviews for Apolipoprotein E/ApoE Recombinant Protein Antigen (NBP2-49565PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Apolipoprotein E/ApoE Recombinant Protein Antigen (NBP2-49565PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein E/ApoE Products

Research Areas for Apolipoprotein E/ApoE Recombinant Protein Antigen (NBP2-49565PEP)

Find related products by research area.

Blogs on Apolipoprotein E/ApoE

There are no specific blogs for Apolipoprotein E/ApoE, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Apolipoprotein E/ApoE Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol APOE