Recombinant Human Apolipoprotein C4 Protein

Images

 
SDS-Page: Recombinant Human Apolipoprotein C4 Protein [H00000346-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Apolipoprotein C4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-101 of Human APOC4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
APOC4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Apolipoprotein C4 Protein

  • APOC4
  • apo-CIV
  • apoC-IV
  • Apolipoprotein C4
  • apolipoprotein C-IV

Background

APOC4( AAH20723, 27 a.a. - 128 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000341-M01
Species: Hu
Applications: WB, ELISA
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
AF4647
Species: Hu
Applications: WB, IHC, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-90274
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1915
Species: Hu, Mu, Rt, Ha, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
H00000346-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Apolipoprotein C4 Recombinant Protein (H00000346-P01) (0)

There are no publications for Apolipoprotein C4 Recombinant Protein (H00000346-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein C4 Recombinant Protein (H00000346-P01) (0)

There are no reviews for Apolipoprotein C4 Recombinant Protein (H00000346-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein C4 Recombinant Protein (H00000346-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein C4 Products

Bioinformatics Tool for Apolipoprotein C4 Recombinant Protein (H00000346-P01)

Discover related pathways, diseases and genes to Apolipoprotein C4 Recombinant Protein (H00000346-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein C4 Recombinant Protein (H00000346-P01)

Discover more about diseases related to Apolipoprotein C4 Recombinant Protein (H00000346-P01).
 

Pathways for Apolipoprotein C4 Recombinant Protein (H00000346-P01)

View related products by pathway.

PTMs for Apolipoprotein C4 Recombinant Protein (H00000346-P01)

Learn more about PTMs related to Apolipoprotein C4 Recombinant Protein (H00000346-P01).

Blogs on Apolipoprotein C4

There are no specific blogs for Apolipoprotein C4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Apolipoprotein C4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APOC4