Recombinant Human APOBEC3F Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human APOBEC3F Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 274 - 372 of Human APOBEC3F partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEIL

Protein/Peptide Type
Partial Recombinant Protein
Gene
APOBEC3F

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human APOBEC3F Protein

  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F
  • Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F
  • ARP8
  • BK150C2.4.MRNA
  • DNA dC->dU-editing enzyme APOBEC-3F
  • EC 3.5.4
  • EC 3.5.4.-
  • induced upon T-cell activation
  • KA6
  • MGC74891

Background

APOBEC3F - apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57602
Species: Hu
Applications: ICC/IF
NBP1-78758
Species: Hu
Applications: WB (-), IP
NBP1-91682
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-22970
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-57440
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-88999
Species: Hu
Applications: IHC, IHC-P
NBP1-76601
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-61628
Species: Hu, Mu
Applications: IP (-), WB, Simple Western, ICC/IF, IHC, IHC-P, PLA
H00057180-B01P
Species: Hu
Applications: WB, ELISA
H00200316-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for APOBEC3F Partial Recombinant Protein (H00200316-Q01) (0)

There are no publications for APOBEC3F Partial Recombinant Protein (H00200316-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOBEC3F Partial Recombinant Protein (H00200316-Q01) (0)

There are no reviews for APOBEC3F Partial Recombinant Protein (H00200316-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APOBEC3F Partial Recombinant Protein (H00200316-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APOBEC3F Products

Bioinformatics Tool for APOBEC3F Partial Recombinant Protein (H00200316-Q01)

Discover related pathways, diseases and genes to APOBEC3F Partial Recombinant Protein (H00200316-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOBEC3F Partial Recombinant Protein (H00200316-Q01)

Discover more about diseases related to APOBEC3F Partial Recombinant Protein (H00200316-Q01).
 

Pathways for APOBEC3F Partial Recombinant Protein (H00200316-Q01)

View related products by pathway.

PTMs for APOBEC3F Partial Recombinant Protein (H00200316-Q01)

Learn more about PTMs related to APOBEC3F Partial Recombinant Protein (H00200316-Q01).

Blogs on APOBEC3F

There are no specific blogs for APOBEC3F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human APOBEC3F Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC3F