Recombinant Human Apc11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Apc11 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 54 of Human ANAPC11 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ANAPC11
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Apc11 Protein

  • anaphase promoting complex subunit 11 (yeast APC11 homolog)
  • anaphase promoting complex subunit 11
  • anaphase-promoting complex subunit 11
  • APC11 anaphase promoting complex subunit 11 homolog
  • APC11Hepatocellular carcinoma-associated RING finger protein
  • Apc11p
  • Cyclosome subunit 11
  • HSPC214
  • MGC882

Background

ANAPC11( AAH00607, 1 a.a. - 55 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051529-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Apc11 Recombinant Protein (H00051529-P01) (0)

There are no publications for Apc11 Recombinant Protein (H00051529-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apc11 Recombinant Protein (H00051529-P01) (0)

There are no reviews for Apc11 Recombinant Protein (H00051529-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apc11 Recombinant Protein (H00051529-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apc11 Products

Bioinformatics Tool for Apc11 Recombinant Protein (H00051529-P01)

Discover related pathways, diseases and genes to Apc11 Recombinant Protein (H00051529-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apc11 Recombinant Protein (H00051529-P01)

Discover more about diseases related to Apc11 Recombinant Protein (H00051529-P01).
 

Pathways for Apc11 Recombinant Protein (H00051529-P01)

View related products by pathway.

Research Areas for Apc11 Recombinant Protein (H00051529-P01)

Find related products by research area.

Blogs on Apc11

There are no specific blogs for Apc11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

APC Antibody
NB100-91662

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Apc11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ANAPC11