Apc11 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Apc11 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANAPC11.
  
  

  Source: E. coli

  Amino Acid Sequence: SPWCLDHSCDLFGITDQVSADGPRACRQGARRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGMEVQGV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ANAPC11
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90140.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Apc11 Recombinant Protein Antigen

• anaphase promoting complex subunit 11 (yeast APC11 homolog)
• anaphase promoting complex subunit 11
• anaphase-promoting complex subunit 11
• APC11 anaphase promoting complex subunit 11 homolog
• APC11Hepatocellular carcinoma-associated RING finger protein
• Apc11p
• Cyclosome subunit 11
• HSPC214
• MGC882

Background

APC11 (anaphase-promoting complex subunit 11) is a member of the E3 enzyme family. This protein contains a RING-H2 domain and has a molecular weight of approximately 9.8 kD. The APC11 protein is distributed diffusely in the cytoplasm and is located in the nucleus with discrete accumulation in granular structures. The APC11 protein is a probable catalytic unit in the APC complex. The APC11 protein functions with other members of the APC complex as a multisubunit cell cycle ubiquitin ligase, and a regulator of sister chromatid separation by degrading securins. In addition, this protein functions in ubiquitin-dependent cyclin catabolism, metaphase/anaphase transition, and spindle elongation. The APC11 protein comprises one subunit of the anaphase promoting complex including APC1-8, and other probable complex proteins APC9-11, Cdc26, Mnd2, Swm1. The APC complex is inactivated by protein kinase A and is activated by CDC20 and Cdh1. In addition to the APC complex proteins, APC11 has been shown to interact with Ubc4. The Poly6116 antibody has been shown to be useful for Western blotting of the human and mouse APC11 protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ANAPC11