AP4S1 Antibody - BSA Free

Western Blot: AP4S1 Antibody [NBP2-82640] - Host: Rabbit. Target Name: Ap4s1. Sample Type: Rat Stomach lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AP4S1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AP4S1 Antibody - BSA Free (NBP2-82640) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ap4s1. Peptide sequence: VSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP4S1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AP4S1 Antibody - BSA Free

• adapter-related protein complex 4 subunit sigma-1
• adaptor-related protein complex 4, sigma 1 subunit
• AP-4 complex subunit sigma-1
• AP47B
• CLA20
• CLAPS4
• CPSQ6
• sigma 4
• sigma-4-adaptin
• sigma4-adaptin

Background

The heterotetrameric adaptor protein (AP) complexes sort integral membrane proteins at various stages of the endocytic and secretory pathways. AP4 is composed of 2 large chains, beta-4 (AP4B1; MIM 607245) and epsilon-4 (AP4E1; MIM 607244), a medium chain, mu-4 (AP4M1; MIM 602296), and a small chain, sigma-4 (AP4S1).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP4S1