AP4M1 Antibody - BSA Free

Western Blot: AP4M1 Antibody [NBP3-10704] - Western blot analysis of AP4M1 in 293T Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AP4M1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AP4M1 Antibody - BSA Free (NBP3-10704) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP4M1 (NP_004713). Peptide sequence QELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP4M1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AP4M1 Antibody - BSA Free

• Adapter-related protein complex 4 mu-1 subunit
• adaptor-related protein complex 4, mu 1 subunit
• adaptor-related protein complex AP-4 mu4 subunit
• AP-4 adapter complex mu subunit
• AP-4 complex subunit mu-1
• CPSQ3
• Mu subunit of AP-4
• mu4
• MU-4
• mu4-adaptin
• Mu-adaptin-related protein 2
• mu-adaptin-related protein-2
• MUARP2
• MU-ARP2

Background

The AP4M1 gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexesmedium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins withtyrosine-based motifs from the

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP4M1