AP4E1 Antibody

Images

 
Immunohistochemistry: AP4E1 Antibody [NBP1-89057] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP4E1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LMVWSVTNKSGLELKSADLEIFPAENFKVTEQPGCCLPVMEAESTKSFQYSVQIEKPFTEGNLTGFISYHMMDTHSAQLEFSVNLSLLDFIRPLKISSDDFGKLWLSFANDVKQNV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP4E1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AP4E1 Protein (NBP1-89057PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AP4E1 Antibody

  • Adapter-related protein complex 4 subunit epsilon-1
  • adaptor-related protein complex 4, epsilon 1 subunit
  • adaptor-related protein complex AP-4 epsilon
  • AP-4 adapter complex subunit epsilon
  • AP-4 complex subunit epsilon-1
  • AP-4-EPSILON
  • DKFZp686L12167
  • Epsilon subunit of AP-4
  • epsilon-adaptin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89060
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88657
Species: Hu
Applications: IHC, IHC-P
NBP1-85514
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89059
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56456
Species: Hu
Applications: ICC/IF, IHC-P
NBL1-09387
Species: Hu
NBP2-57109
Species: Hu
Applications: WB, ICC/IF
NBP2-49265
Species: Hu
Applications: IHC, IHC-P
MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
NBP2-46862
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001175-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5526
Species: Hu, Mu
Applications: WB
NBP2-39027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89058
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for AP4E1 Antibody (NBP1-89057) (0)

There are no publications for AP4E1 Antibody (NBP1-89057).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP4E1 Antibody (NBP1-89057) (0)

There are no reviews for AP4E1 Antibody (NBP1-89057). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AP4E1 Antibody (NBP1-89057) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP4E1 Products

Bioinformatics Tool for AP4E1 Antibody (NBP1-89057)

Discover related pathways, diseases and genes to AP4E1 Antibody (NBP1-89057). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP4E1 Antibody (NBP1-89057)

Discover more about diseases related to AP4E1 Antibody (NBP1-89057).
 

Pathways for AP4E1 Antibody (NBP1-89057)

View related products by pathway.

Blogs on AP4E1

There are no specific blogs for AP4E1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP4E1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP4E1