AP2S1 Antibody (3E4.)

Images

 
Western Blot: AP2S1 Antibody (3E4) [H00001175-M01] - Analysis of AP2S1 expression in transfected 293T cell line by AP2S1 monoclonal antibody (M01), clone 3E4.Lane 1: AP2S1 transfected lysate(17 KDa).Lane 2: ...read more
Western Blot: AP2S1 Antibody (3E4) [H00001175-M01] - Analysis of AP2S1 over-expressed 293 cell line, cotransfected with AP2S1 Validated Chimera RNAi ( Cat # H00001175-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Sandwich ELISA: AP2S1 Antibody (3E4) [H00001175-M01] - Detection limit for recombinant GST tagged AP2S1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
3E4.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AP2S1 Antibody (3E4.) Summary

Immunogen
AP2S1 (AAH06337, 1 a.a. - 142 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Specificity
AP2S1 (3E4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AP2S1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA and RNAi Validation.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AP2S1 Antibody (3E4.)

  • Adapter-related protein complex 2 sigma subunit
  • Adaptor protein complex AP-2 subunit sigma
  • adaptor-related protein complex 2, sigma 1 subunit
  • AP17HA2 17 kDa subunit
  • AP-2 complex subunit sigma
  • CLAPS2AP17-DELTA
  • Clathrin assembly protein 2 small chain
  • Clathrin coat assembly protein AP17
  • Clathrin coat-associated protein AP17
  • clathrin-associated/assembly/adaptor protein, small 2 (17kD)
  • Plasma membrane adaptor AP-2 17 kDa protein
  • sigma2-adaptin

Background

One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing has been observed in this gene and results in two known transcripts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46862
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49265
Species: Hu
Applications: IHC, IHC-P
MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP2-00834
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBL1-09387
Species: Hu
NBP2-46738
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91674
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15563
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57109
Species: Hu
Applications: WB, ICC/IF
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001175-M01
Species: Hu
Applications: WB, ELISA, RNAi

Publications for AP2S1 Antibody (H00001175-M01) (0)

There are no publications for AP2S1 Antibody (H00001175-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP2S1 Antibody (H00001175-M01) (0)

There are no reviews for AP2S1 Antibody (H00001175-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP2S1 Antibody (H00001175-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP2S1 Products

Bioinformatics Tool for AP2S1 Antibody (H00001175-M01)

Discover related pathways, diseases and genes to AP2S1 Antibody (H00001175-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP2S1 Antibody (H00001175-M01)

Discover more about diseases related to AP2S1 Antibody (H00001175-M01).
 

Pathways for AP2S1 Antibody (H00001175-M01)

View related products by pathway.

Blogs on AP2S1

There are no specific blogs for AP2S1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP2S1 Antibody (3E4.) and receive a gift card or discount.

Bioinformatics

Gene Symbol AP2S1
Entrez
OMIM
Uniprot