AP4B1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related AP4B1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-88657PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

AP4B1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AP4B1.

Source: E. coli

Amino Acid Sequence: LIPEENKERVQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AP4B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88657.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AP4B1 Recombinant Protein Antigen

  • Adapter-related protein complex 4 subunit beta-1
  • adaptor-related protein complex 4, beta 1 subunit
  • AP-4 adapter complex subunit beta
  • AP-4 complex subunit beta-1
  • beta 4 subunit of AP-4
  • Beta subunit of AP-4
  • BETA-4
  • beta4-adaptin

Background

AP4B1, or AP-4 complex subunit beta-1, consists of a 739 amino acid isoform that is 83 kDa, and is involved in targeting specific proteins that move between the trans-Golgi network and the endosomal-lysosomal system. The AP4B1 protein is included in current research on a variety of diseases and disorders including cerebral palsy, neuronitis, malaria, spasticity, spastic paraplegia, hypotonia, intellectual disability, and cerebritis. The protein interacts with AP4E1, MY, AP4M1, BUB1, and BUB1B in several biological processes, such as membrane trafficking, Golgi associated vesicle biogenesis, and clathrin derived vesicle budding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76990
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-59263
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-83126
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83942
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-84912
Species: Hu
Applications: IHC,  IHC-P
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, WB
NBP3-14647
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-45564
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76816
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-61674
Species: Hu
Applications: ELISA, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
H00010908-M08
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB

Publications for AP4B1 Protein (NBP1-88657PEP) (0)

There are no publications for AP4B1 Protein (NBP1-88657PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP4B1 Protein (NBP1-88657PEP) (0)

There are no reviews for AP4B1 Protein (NBP1-88657PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AP4B1 Protein (NBP1-88657PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AP4B1 Products

Array NBP1-88657PEP

Blogs on AP4B1

There are no specific blogs for AP4B1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AP4B1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AP4B1