Recombinant Human AP4B1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AP4B1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 640-739 of Human AP4B1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELLLEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AP4B1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AP4B1 Protein

  • Adapter-related protein complex 4 subunit beta-1
  • adaptor-related protein complex 4, beta 1 subunit
  • AP-4 adapter complex subunit beta
  • AP-4 complex subunit beta-1
  • beta 4 subunit of AP-4
  • Beta subunit of AP-4
  • BETA-4
  • beta4-adaptin

Background

AP4B1 - adaptor-related protein complex 4, beta 1 subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82143
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59263
Species: Hu
Applications: WB, IHC
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83942
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84912
Species: Hu
Applications: IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for AP4B1 Partial Recombinant Protein (H00010717-Q01) (0)

There are no publications for AP4B1 Partial Recombinant Protein (H00010717-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP4B1 Partial Recombinant Protein (H00010717-Q01) (0)

There are no reviews for AP4B1 Partial Recombinant Protein (H00010717-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP4B1 Partial Recombinant Protein (H00010717-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AP4B1 Products

Bioinformatics Tool for AP4B1 Partial Recombinant Protein (H00010717-Q01)

Discover related pathways, diseases and genes to AP4B1 Partial Recombinant Protein (H00010717-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP4B1 Partial Recombinant Protein (H00010717-Q01)

Discover more about diseases related to AP4B1 Partial Recombinant Protein (H00010717-Q01).
 

Pathways for AP4B1 Partial Recombinant Protein (H00010717-Q01)

View related products by pathway.

Blogs on AP4B1

There are no specific blogs for AP4B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD4 Antibody
NBP1-19371
AP4B1 Antibody
NBP1-88657

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AP4B1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AP4B1