AP4B1 Antibody

Immunohistochemistry-Paraffin: AP4B1 Antibody [NBP1-88657] - Staining of human Lymph node shows strong granular cytoplasmic positivity in germinal and non-germinal center cells.

Immunohistochemistry: AP4B1 Antibody [NBP1-88657] - Staining of human kidney shows strong cytoplasmic positivity with granular pattern in renal tubules.

Immunohistochemistry-Paraffin: AP4B1 Antibody [NBP1-88657] - Staining of human Duodenum shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: AP4B1 Antibody [NBP1-88657] - Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: AP4B1 Antibody [NBP1-88657] - Staining of human Testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and leydig cells.

Product Discontinued

AP4B1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LIPEENKERVQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP4B1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AP4B1 Antibody

• Adapter-related protein complex 4 subunit beta-1
• adaptor-related protein complex 4, beta 1 subunit
• AP-4 adapter complex subunit beta
• AP-4 complex subunit beta-1
• beta 4 subunit of AP-4
• Beta subunit of AP-4
• BETA-4
• beta4-adaptin

Background

AP4B1, or AP-4 complex subunit beta-1, consists of a 739 amino acid isoform that is 83 kDa, and is involved in targeting specific proteins that move between the trans-Golgi network and the endosomal-lysosomal system. The AP4B1 protein is included in current research on a variety of diseases and disorders including cerebral palsy, neuronitis, malaria, spasticity, spastic paraplegia, hypotonia, intellectual disability, and cerebritis. The protein interacts with AP4E1, MY, AP4M1, BUB1, and BUB1B in several biological processes, such as membrane trafficking, Golgi associated vesicle biogenesis, and clathrin derived vesicle budding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP4B1