AP4B1 Antibody

Images

 
Immunohistochemistry: AP4B1 Antibody [NBP1-88657] - Staining of human kidney shows strong cytoplasmic positivity with granular pattern in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP4B1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LIPEENKERVQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP4B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AP4B1 Protein (NBP1-88657PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AP4B1 Antibody

  • Adapter-related protein complex 4 subunit beta-1
  • adaptor-related protein complex 4, beta 1 subunit
  • AP-4 adapter complex subunit beta
  • AP-4 complex subunit beta-1
  • beta 4 subunit of AP-4
  • Beta subunit of AP-4
  • BETA-4
  • beta4-adaptin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82143
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59263
Species: Hu
Applications: WB, IHC
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83942
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84912
Species: Hu
Applications: IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for AP4B1 Antibody (NBP1-88657) (0)

There are no publications for AP4B1 Antibody (NBP1-88657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP4B1 Antibody (NBP1-88657) (0)

There are no reviews for AP4B1 Antibody (NBP1-88657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AP4B1 Antibody (NBP1-88657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP4B1 Products

Bioinformatics Tool for AP4B1 Antibody (NBP1-88657)

Discover related pathways, diseases and genes to AP4B1 Antibody (NBP1-88657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP4B1 Antibody (NBP1-88657)

Discover more about diseases related to AP4B1 Antibody (NBP1-88657).
 

Pathways for AP4B1 Antibody (NBP1-88657)

View related products by pathway.

Blogs on AP4B1

There are no specific blogs for AP4B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP4B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP4B1