We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

AP3S2 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related AP3S2 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-31887PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

AP3S2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AP3S2.

Source: E. coli

Amino Acid Sequence: LDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AP3S2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31887.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AP3S2 Recombinant Protein Antigen

  • Adapter-related protein complex 3 sigma-2 subunit
  • adaptor complex sigma3B
  • adaptor-related protein complex 3, sigma 2 subunit
  • AP-3 complex subunit sigma-2
  • AP-3 complex subunit sigma-3B
  • AP3S3
  • clathrin-associated/assembly/adaptor protein, small 4, 22-kD
  • FLJ35955
  • sigma3b
  • sigma-3B-adaptin
  • Sigma3B-adaptin
  • Sigma-adaptin 3b

Background

Part of the AP-3 complex. an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36754
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-97218
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-83833
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
AF5924
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-49643
Species: Bv, Hu, Pm
Applications: Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, KO, WB
NBP3-46615
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP3-48467
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-32619
Species: Hu
Applications: IHC,  IHC-P
NBP2-46862
Species: Hu
Applications: ICC/IF, WB
H00001175-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP1-76588
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, WB
NBP1-86149
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
NBP1-89679
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P

Publications for AP3S2 Recombinant Protein Antigen (NBP2-31887PEP) (0)

There are no publications for AP3S2 Recombinant Protein Antigen (NBP2-31887PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP3S2 Recombinant Protein Antigen (NBP2-31887PEP) (0)

There are no reviews for AP3S2 Recombinant Protein Antigen (NBP2-31887PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AP3S2 Recombinant Protein Antigen (NBP2-31887PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AP3S2 Products

Research Areas for AP3S2 Recombinant Protein Antigen (NBP2-31887PEP)

Find related products by research area.

Blogs on AP3S2

There are no specific blogs for AP3S2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AP3S2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AP3S2