Recombinant Human AP2 alpha Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AP2 alpha Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-437 of Human TFAP2A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TFAP2A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AP2 alpha Protein

  • Activating enhancer-binding protein 2-alpha
  • Activator protein 2
  • AP-2 transcription factor
  • AP2-alpha
  • AP2TFAP-2alpha
  • AP-2transcription factor AP-2 alpha (activating enhancer-binding protein 2 alpha)
  • BOFS
  • FLJ51761
  • TFAP2
  • transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
  • transcription factor AP-2-alpha

Background

AP2-alpha is a 52-kD retinoic acid-inducible and developmentally regulated activator of transcription that binds to a consensus DNA-binding sequence CCCCAGGC in the SV40 and metallothionein (MIM 156350) promoters.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5059
Species: Hu
Applications: WB, IHC
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF5634
Species: Hu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00007020-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for AP2 alpha Recombinant Protein (H00007020-P01) (0)

There are no publications for AP2 alpha Recombinant Protein (H00007020-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP2 alpha Recombinant Protein (H00007020-P01) (0)

There are no reviews for AP2 alpha Recombinant Protein (H00007020-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP2 alpha Recombinant Protein (H00007020-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AP2 alpha Products

Bioinformatics Tool for AP2 alpha Recombinant Protein (H00007020-P01)

Discover related pathways, diseases and genes to AP2 alpha Recombinant Protein (H00007020-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP2 alpha Recombinant Protein (H00007020-P01)

Discover more about diseases related to AP2 alpha Recombinant Protein (H00007020-P01).
 

Pathways for AP2 alpha Recombinant Protein (H00007020-P01)

View related products by pathway.

PTMs for AP2 alpha Recombinant Protein (H00007020-P01)

Learn more about PTMs related to AP2 alpha Recombinant Protein (H00007020-P01).
 

Research Areas for AP2 alpha Recombinant Protein (H00007020-P01)

Find related products by research area.

Blogs on AP2 alpha

There are no specific blogs for AP2 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ErbB2/Her2
1129-ER-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AP2 alpha Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TFAP2A