AP1M2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

AP1M2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AP1M2
  
  

  Source: E.coli

  Amino Acid Sequence: PYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: AP1M2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25278It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AP1M2 Recombinant Protein Antigen

• Adaptor protein complex AP-1 mu-2 subunit
• Adaptor-related protein complex 1 mu-2 subunit
• adaptor-related protein complex 1, mu 2 subunit
• AP-1 complex subunit mu-2
• AP1-mu2
• AP-mu chain family member mu1B
• Clathrin assembly protein complex 1 medium chain 2
• clathrin coat assembly protein AP47 2
• clathrin coat associated protein AP47 2
• clathrin-associated adaptor medium chain mu2
• golgi adaptor AP-1 47 kDa protein
• Golgi adaptor HA1/AP1 adaptin mu-2 subunit
• HA1 47 kDa subunit 2
• HSMU1B
• MU1B
• MU-1B
• mu1B-adaptin
• mu2
• Mu-adaptin 2

Background

AP1M2 encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP1M2